KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654813
Entry
104654813         CDS       T03989                                 

Gene name
PRKG2
Definition
(RefSeq) cGMP-dependent protein kinase 2 isoform X1
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04730  Long-term depression
rro04740  Olfactory transduction
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104654813 (PRKG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104654813 (PRKG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104654813 (PRKG2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104654813 (PRKG2)
   04924 Renin secretion
    104654813 (PRKG2)
  09154 Digestive system
   04970 Salivary secretion
    104654813 (PRKG2)
  09156 Nervous system
   04730 Long-term depression
    104654813 (PRKG2)
  09157 Sensory system
   04740 Olfactory transduction
    104654813 (PRKG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104654813 (PRKG2)
   04714 Thermogenesis
    104654813 (PRKG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104654813 (PRKG2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     104654813 (PRKG2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKG family
   104654813 (PRKG2)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like RNase_Y_N Spc7 UPF0242 Crescentin APH FeoB_N MPS2 FAM76 NPV_P10 ATG16
Other DBs
NCBI-GeneID: 104654813
NCBI-ProteinID: XP_010352414
UniProt: A0A2K6PHR0
LinkDB
Position
2
AA seq 762 aa
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYNLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHQKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELNGPIDHSYFDKYPPEKGMPPDELSGWDKDF
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacctaaacattccaagcacccagatggacactctgggaac
ctcaccactgatgctctgcggaacaaggtgacagagctggagagagagttgaggaggaag
gatgctgagatccaggagagggagtacaatttgaaggagctgcgggagcagctgtcgaag
cagaccgtggccattgctgaactcacagaagagctccagaacaagtgcatccagctgaac
aagctgcaggatgtggtgcatatgcagggaggaagcccgcttcaggcttctccagataaa
gtgcctcttgaggtccaccagaagacctctggattggtctctctccatagcaggagggga
gcaaaggctggcgtgtctgctgagccaacaacccggacctatgacctcaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaagactccagtgagaagaagctcattaca
gacgcccttaataaaaatcagtttctgaaaagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctggcagagggtcgactagaggtgttccaaggggagaaa
ttgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaactgt
acaaggactgcctctgtgaaagctattaccaatgttaaaacatgggcgctagatcgagag
gtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgataaaggagattacatcattagagagggcgaggaagga
agtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagtacagaaggccat
gatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgatgatgtcaggtcagctaacattattgctgaagaaaatgatgttgcatgcctg
gttatagatcgagaaacattcaaccaaactgttggtacatttgaagagctgcaaaaatac
cttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcgaagcggtcc
atgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggagaag
gtggccagattttcctcatcatccccattccagaaccttgagattattgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaagtaaaaaatgaaaatgttgcttttgct
atgaagtgtataaggaagaagcacatagttgacaccaagcagcaggagcatgtctactca
gagaagaggatcttagaggagctgtgctctccattcattgtgaaattatatcgtactttc
aaggacaataagtatgtatacatgcttctggaggcctgcttaggtggggagctatggagt
atattaagggacagaggcagctttgatgaacccacctccaaattctgcgttgcttgtgtg
acagaagcatttgattacctgcatcgactaggtattatctacagagacttaaaaccagaa
aacttaattctagatgctgagggttaccttaaattggttgactttggatttgcgaagaaa
atagggtctggacagaaaacatggacattctgtgggactccagaatatgtagctcctgaa
gtcattctcaacaaaggacatgacttcagtgtggatttctggtcactgggaattctagtg
tatgagcttctaacgggcaacccacccttttctgggattgaccaaatgatgacctacaac
ttgattctcaaaggaattgaaaaaatggattttcccaggaagataacacggcgacctgag
gatttgattcgaaggctttgcaggcaaaatccaacagaaaggctgggaaatctgaagaat
ggaataaatgacattaagaaacacaggtggttaaatggttttaattgggagggactgaaa
gcacggagccttccatcacctttacaaagagagctcaatggacccatagatcacagctac
tttgacaaatatcctcctgaaaagggaatgcctccagatgagctatcaggctgggataaa
gacttctga

DBGET integrated database retrieval system