KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654871
Entry
104654871         CDS       T03989                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104654871 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104654871 (ADCY6)
   04371 Apelin signaling pathway
    104654871 (ADCY6)
   04072 Phospholipase D signaling pathway
    104654871 (ADCY6)
   04024 cAMP signaling pathway
    104654871 (ADCY6)
   04022 cGMP-PKG signaling pathway
    104654871 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104654871 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104654871 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104654871 (ADCY6)
   04062 Chemokine signaling pathway
    104654871 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    104654871 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    104654871 (ADCY6)
   04912 GnRH signaling pathway
    104654871 (ADCY6)
   04913 Ovarian steroidogenesis
    104654871 (ADCY6)
   04915 Estrogen signaling pathway
    104654871 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    104654871 (ADCY6)
   04921 Oxytocin signaling pathway
    104654871 (ADCY6)
   04926 Relaxin signaling pathway
    104654871 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    104654871 (ADCY6)
   04918 Thyroid hormone synthesis
    104654871 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    104654871 (ADCY6)
   04916 Melanogenesis
    104654871 (ADCY6)
   04924 Renin secretion
    104654871 (ADCY6)
   04925 Aldosterone synthesis and secretion
    104654871 (ADCY6)
   04927 Cortisol synthesis and secretion
    104654871 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104654871 (ADCY6)
   04270 Vascular smooth muscle contraction
    104654871 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    104654871 (ADCY6)
   04971 Gastric acid secretion
    104654871 (ADCY6)
   04972 Pancreatic secretion
    104654871 (ADCY6)
   04976 Bile secretion
    104654871 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104654871 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104654871 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    104654871 (ADCY6)
   04727 GABAergic synapse
    104654871 (ADCY6)
   04725 Cholinergic synapse
    104654871 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    104654871 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    104654871 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    104654871 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    104654871 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    104654871 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104654871 (ADCY6)
   04714 Thermogenesis
    104654871 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654871 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    104654871 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104654871 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104654871 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104654871 (ADCY6)
   05163 Human cytomegalovirus infection
    104654871 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104654871 (ADCY6)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104654871 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 104654871
NCBI-ProteinID: XP_030794271
LinkDB
Position
10
AA seq 1169 aa
MSWFSGLLVPKVDERKTAWGERNGQKRSRRCGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTVGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFLGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPPRWVPDRAFSRTKDSKAF
RQMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEK
KYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSILMLGIYASIFLLLLVTVLICAVYS
CGSLFPKALQHLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNL
TPADITACHLQQLNYSLGLDAPLCEGTTPTCSFPEYFIGSVLLSLLASSVFLHISSIGKL
AMVFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTP
VILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAH
FLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEII
SEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFN
NFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAK
GYQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtgcctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcacggcgctgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacgccttcatccggaggggcggcccaggcaagggcaag
gagctggggttgcgggcagtggccctgggcttcgaggacaccgaggtgacaacgacagtg
ggcgggacagctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacggcggtgctgctggctttccacgcggcgcccgcccgccctcagcctgcctat
gtggccctgctggcctgcgccgccgctctgttcctggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgccctcgcagcagacccacgcagcccctctgcgggcctctgg
tgccctgtgttcttcgtctacatcgcctacacgctcctccccatccgcatgcgggctgcg
gtcctcagcggcctgggcctctccaccctgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctgtggaagcagctcggtgccaatgtgctgctgttcctctgcaccaac
gtcattggcatctgcacacactatccagcagaggtgtctcagcgccaggcctttcaggag
acccgtggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtgttgccccagcatgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccataaaatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcactgcacaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccggaagcccgg
gccgaccatgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcatccacagcgggcgtgtg
cactgcggtgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaacggggactacgaggtggagccaggccgtggtggcgagcgcaacgca
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgccgcgctgggtgcctgatcgtgccttttcccggaccaaggactccaaggccttc
cgccagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaac
cctgaggatgaggtggatgaattcctgagccgtgccatcgatgcccgcagcattgatcag
ctgcggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaag
aagtactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtc
ttctgcttcatctgcttcatccagcttctcatcttcccacactccatcttgatgcttggg
atctatgccagcatcttcctgctgctgctggtcaccgtgctgatctgtgccgtgtactcc
tgtggttctctgttccctaaggccctgcaacatctgtcccgcagcatcgttcgctcacgg
gcacatagcaccgcagttggcatcttttccgtcctgcttgtgttcacttctgccattgcc
aacatgttcacctgtaatcacacccccatacggacctgtgcagcccggatgctgaattta
acacctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggat
gctcccctgtgtgagggcaccacgcccacctgcagcttccctgagtacttcatcgggagc
gtgctgctgagtctcttggccagctctgtcttcctgcacatcagcagcatcgggaagttg
gccatggtctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagcc
accatctttgacaactatgacctactgcttggcgtccatggcttggcttcttccaatgag
acctttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccct
gtgattctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgact
gcccgcctagacttcctctggaaactacaggcaacaggggagaaggaggagatggaggag
ctacaggcatacaaccggaggctgctgcataacattctgcccaaggacgtggccgcccac
ttcctggcccgggagcgtcgcaatgatgaactctactatcagtcgtgtgagtgtgtggct
gttatgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaat
gagggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagatcatc
agcgaggagcggttccggcagctggaaaagatcaagacaattggtagcacctacatggct
gcctcagggctgaacgccagcacctacgatcaggtgggccgctcccacatcactgccctg
gctgactacgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaac
aatttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcattggggct
cggaagccgcagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagc
acgggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaag
ggctaccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacc
tacttcctcaatgggggccccagcagttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658457
Entry
104658457         CDS       T03989                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04740  Olfactory transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104658457 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104658457 (ADCY3)
   04371 Apelin signaling pathway
    104658457 (ADCY3)
   04020 Calcium signaling pathway
    104658457 (ADCY3)
   04072 Phospholipase D signaling pathway
    104658457 (ADCY3)
   04024 cAMP signaling pathway
    104658457 (ADCY3)
   04022 cGMP-PKG signaling pathway
    104658457 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104658457 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104658457 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104658457 (ADCY3)
   04062 Chemokine signaling pathway
    104658457 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    104658457 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    104658457 (ADCY3)
   04912 GnRH signaling pathway
    104658457 (ADCY3)
   04913 Ovarian steroidogenesis
    104658457 (ADCY3)
   04915 Estrogen signaling pathway
    104658457 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    104658457 (ADCY3)
   04921 Oxytocin signaling pathway
    104658457 (ADCY3)
   04926 Relaxin signaling pathway
    104658457 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    104658457 (ADCY3)
   04918 Thyroid hormone synthesis
    104658457 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    104658457 (ADCY3)
   04916 Melanogenesis
    104658457 (ADCY3)
   04925 Aldosterone synthesis and secretion
    104658457 (ADCY3)
   04927 Cortisol synthesis and secretion
    104658457 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104658457 (ADCY3)
   04270 Vascular smooth muscle contraction
    104658457 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    104658457 (ADCY3)
   04971 Gastric acid secretion
    104658457 (ADCY3)
   04972 Pancreatic secretion
    104658457 (ADCY3)
   04976 Bile secretion
    104658457 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104658457 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104658457 (ADCY3)
   04727 GABAergic synapse
    104658457 (ADCY3)
   04725 Cholinergic synapse
    104658457 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    104658457 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    104658457 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    104658457 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    104658457 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    104658457 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104658457 (ADCY3)
   04714 Thermogenesis
    104658457 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658457 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    104658457 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104658457 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104658457 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104658457 (ADCY3)
   05163 Human cytomegalovirus infection
    104658457 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104658457 (ADCY3)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104658457 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 104658457
NCBI-ProteinID: XP_010356803
UniProt: A0A2K6RIQ3
LinkDB
Position
17
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYLLWLLITAQIFSYLGLNFTRAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGETLLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETEGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAAINLYAWRPVFDEYDHRRFREHDSLPMVTLEKMQGFTPGLNGTDGLPLVPSK
YSMMVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGPSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgctgccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacctgctgtggctgctcataactgcccagatcttctcttacctgggcctgaacttcacg
cgtgcccacgcggccagtgacaccgtgggctggcaggtcttcttcgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgataatctccgtggtctcctgtgtggtg
cacaccttggtcttgggggtcactgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
cttcggattaagatcctgggtgactgctactactgcatctgcggcctgcctgactaccgt
gaggaccacgccgtctgctccatcctcatggggcttgccatggtggaagccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcgactgacgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgttcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggaaccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacgtcggagaaacccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccgcgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctcc
gaagacgagcacgagctcaaccagctgctcaacgaggccctgctcgagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcctgtccatgcggttcatggaccctgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgt
gtcgtcctgctctgcacggctctggttgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtgggggagacgctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacaggacccagcaacgcgacagcaggg
atggagacagagggtggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcgcgggcgccgtggccgccatcaacctctacgcctggcgccccgtcttcgat
gaatacgaccacaggcgttttcgggagcatgacagcttacctatggtgaccttagagaag
atgcagggattcactcctgggctcaacggcactgacgggctgcccctggtgccttccaag
tactccatgatggtgatggtgttcctcatgatgctgagcttctactacttctcccgccac
gtagaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggcggtattgagtgtctgcgtttcctcaatgaaatcatctcagatttt
gactctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagc
acgtatatggcggcttcaggagtcacccctgatgtcaacaccaatggctttgccagctcc
aacaaggaggacaagtctgagagagaacgctggcagcacctggctgacctggccgacttt
gcgctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaacca
cactacgacatctggggcaatacggtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacatccaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgc
tttgtgaggcggggccccatctttgtgaaggggaagggggagctgctgaccttcttcttg
aaggggcgggacaagccagccaccttccccaacggcccctctgtcacactgccccaccag
gtggtagacaactcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662674
Entry
104662674         CDS       T03989                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104662674 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104662674 (ADCY4)
   04371 Apelin signaling pathway
    104662674 (ADCY4)
   04020 Calcium signaling pathway
    104662674 (ADCY4)
   04072 Phospholipase D signaling pathway
    104662674 (ADCY4)
   04024 cAMP signaling pathway
    104662674 (ADCY4)
   04022 cGMP-PKG signaling pathway
    104662674 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104662674 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104662674 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104662674 (ADCY4)
   04062 Chemokine signaling pathway
    104662674 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    104662674 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    104662674 (ADCY4)
   04912 GnRH signaling pathway
    104662674 (ADCY4)
   04913 Ovarian steroidogenesis
    104662674 (ADCY4)
   04915 Estrogen signaling pathway
    104662674 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    104662674 (ADCY4)
   04921 Oxytocin signaling pathway
    104662674 (ADCY4)
   04926 Relaxin signaling pathway
    104662674 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    104662674 (ADCY4)
   04918 Thyroid hormone synthesis
    104662674 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    104662674 (ADCY4)
   04916 Melanogenesis
    104662674 (ADCY4)
   04925 Aldosterone synthesis and secretion
    104662674 (ADCY4)
   04927 Cortisol synthesis and secretion
    104662674 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104662674 (ADCY4)
   04270 Vascular smooth muscle contraction
    104662674 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    104662674 (ADCY4)
   04971 Gastric acid secretion
    104662674 (ADCY4)
   04972 Pancreatic secretion
    104662674 (ADCY4)
   04976 Bile secretion
    104662674 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    104662674 (ADCY4)
   04727 GABAergic synapse
    104662674 (ADCY4)
   04725 Cholinergic synapse
    104662674 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    104662674 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    104662674 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    104662674 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    104662674 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    104662674 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104662674 (ADCY4)
   04714 Thermogenesis
    104662674 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662674 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    104662674 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104662674 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104662674 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662674 (ADCY4)
   05163 Human cytomegalovirus infection
    104662674 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104662674 (ADCY4)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104662674 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 104662674
NCBI-ProteinID: XP_010362015
LinkDB
Position
5
AA seq 1190 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLQEKTLASFSPQWSLDRSRNPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCALKGPKMLHWLPALSGLVATRP
GLRIALSTATILLVFALATTSLDLDSFLEFYSWRAPGNHPSAKLQKRKLRPREAKWLARA
HTVAQSQRSTLDAPHITPPPVRTPVLRFPSLPEIAESTPLDESGPDSSLGQLKPSTSHHC
AQETTCLFSSSSPLQFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTL
GFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIVRLYLGPLDSRPGVLKE
PKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLP
AHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIA
DFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALG
SKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQ
VTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRSGPPSVTLG
NT seq 3573 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccaccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgcggttgcctgggccagcggcagggagctgacttcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgtcctctgtccggcttggtgtgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctactggtcctggggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaatgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccttgcactcgcgccggcggctggacaccgaaaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagaaagcaccaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacattgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagtttgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccggactgccactctcactgccagaccatgccatcaac
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagtgtactctgtggagtcatcggg
ctgcagaagtggcagtatgacgtttggtcccatgatgttacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggatccctaccttcgggagctaggg
gagcccacttatctggtcattgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctctcctcgcttgagggccccaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagccct
gtgtccacctccacccctctccaggagaagaccctggcttccttcagcccccagtggagc
ctagatcgaagccgtaacccccgtggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcacagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctgatgaggtgtgccctg
aaaggccccaagatgctgcattggctgcctgcactgtctggcttggtggccacacgacca
ggactgagaatagccttgagcaccgccaccatcctccttgtctttgccctggccactacc
agcctggatttagactcattcctagaattctattcctggagggcacctgggaatcaccca
tcagccaagttacagaagaggaagctaaggcccagagaggctaagtggctggcaagagct
cacacagtggctcagagtcagagaagtactcttgatgcccctcacataactcctccccca
gtgaggaccccagtgctgaggttcccttccctaccagaaatagcagaatccacccctttg
gacgagtctggccctgactcatctctgggtcagctgaaacccagcacaagccaccattgt
gcccaagaaactacctgcctcttcagctcctcatctcctctgcagttcttcttcccaaca
tcatcagactgccctttccaagctcccaatgtgtcctccatgatttccaacctctcctgg
gagctccctgggtctctgcctctcatcagtgtcccatactccatgcactgctgcacgctg
ggcttcctctcctgctccctctttctgcacatgagcttcgagctgaagctgctgctgctc
ctgctgtggctggcggcatcctgctccctcttcctacactcccacgcctggctgtccgac
tgcctcatcgtccgcctctatctgggccccttggactccaggcccggagtgctgaaggag
cccaaactcatgggtgctatctccttcttcatcttcttcttcaccctccttgtcctggct
cgccagaatgagtactactgccgcctggacttcctgtggaagaagaagctgaggcaggag
cgggaggagacagagacgatggagaacctgactcggctgctcttggagaatgtgctccct
gcacacgtggccccccagttcattggccagaaccggcgcaacgaggatctctaccaccag
tcctacgaatgcgtttgtgtcctcttcgcttcagtcccagacttcaaggagttctactct
gaatccaacatcaatcatgagggcctagagtgtctgaggctgctcaatgaaataattgct
gattttgatgagctgctctccaagcccaagttcagtggggtggagaagatcaagaccatt
ggcagcacctacatggcagccacaggattaaatgccacctctggacaggatgcacaacag
gatgctgaacggagctgcagccaccttggcactatggtggaatttgccgttgccctgggg
tctaagctggacgtcatcaacaagcattcattcaacaacttccgcctgcgtgtggggttg
aaccatggaccagtagtagctggagttattggggcccagaagccacaatatgacatttgg
ggcaacacagtgaacgtggccagccgcatggagagtacaggagtccttggcaaaatccaa
gtgactgaggagacagcctgggccctacagtccctgggctacacctgctacagccggggg
gtcatcaaggtgaaaggcaaagggcagctctgcacctacttcctgaacacagacttgaca
cgaagtggacctccttcagttaccctaggctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668142
Entry
104668142         CDS       T03989                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05012  Parkinson disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104668142 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104668142 (ADCY5)
   04371 Apelin signaling pathway
    104668142 (ADCY5)
   04072 Phospholipase D signaling pathway
    104668142 (ADCY5)
   04024 cAMP signaling pathway
    104668142 (ADCY5)
   04022 cGMP-PKG signaling pathway
    104668142 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104668142 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104668142 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104668142 (ADCY5)
   04062 Chemokine signaling pathway
    104668142 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    104668142 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    104668142 (ADCY5)
   04912 GnRH signaling pathway
    104668142 (ADCY5)
   04913 Ovarian steroidogenesis
    104668142 (ADCY5)
   04915 Estrogen signaling pathway
    104668142 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    104668142 (ADCY5)
   04921 Oxytocin signaling pathway
    104668142 (ADCY5)
   04926 Relaxin signaling pathway
    104668142 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    104668142 (ADCY5)
   04918 Thyroid hormone synthesis
    104668142 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    104668142 (ADCY5)
   04916 Melanogenesis
    104668142 (ADCY5)
   04924 Renin secretion
    104668142 (ADCY5)
   04925 Aldosterone synthesis and secretion
    104668142 (ADCY5)
   04927 Cortisol synthesis and secretion
    104668142 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104668142 (ADCY5)
   04270 Vascular smooth muscle contraction
    104668142 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    104668142 (ADCY5)
   04971 Gastric acid secretion
    104668142 (ADCY5)
   04972 Pancreatic secretion
    104668142 (ADCY5)
   04976 Bile secretion
    104668142 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    104668142 (ADCY5)
   04727 GABAergic synapse
    104668142 (ADCY5)
   04725 Cholinergic synapse
    104668142 (ADCY5)
   04728 Dopaminergic synapse
    104668142 (ADCY5)
   04726 Serotonergic synapse
    104668142 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    104668142 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104668142 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    104668142 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    104668142 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104668142 (ADCY5)
   04714 Thermogenesis
    104668142 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668142 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104668142 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    104668142 (ADCY5)
   05031 Amphetamine addiction
    104668142 (ADCY5)
   05032 Morphine addiction
    104668142 (ADCY5)
   05034 Alcoholism
    104668142 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104668142 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104668142 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668142 (ADCY5)
   05163 Human cytomegalovirus infection
    104668142 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104668142 (ADCY5)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104668142 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD HILPDA
Other DBs
NCBI-GeneID: 104668142
NCBI-ProteinID: XP_030797986
LinkDB
Position
1
AA seq 1262 aa
MSSSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQR
RGAAGGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVE
GGEESGDGGSSADSRSGVGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLVIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSVFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGV
FTITLVFLAAFVNMFTCNSKDLLGCLALEHNISASQVNACHVAESAVNYSLGDEQGFCGS
PWPNCNFPEYFTYSVLLSLLACSVFLQINCIGKLALMLAIELIYVLIVEVPGVTLFDNAD
LLVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagaagactgcggcgccg
gcgccccggggaggccccgaacaccgctcggcgtggggcgaggccgattcccgcgcgaat
ggctacccccatgcccccgggggttctgcccgcggctccaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgac
gatcctccgctgagcggcgacgatcccctggccgggggcttcggcttcagcttccgctcc
aagtctgcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcaacgg
cggggcgcggccggcgggggcagcacccgggcgccccctgcgggcggcggcggcggctcg
gcggcggcggctgcctcggcgggcgggacggaggtgcgccctcgctcggtggaggtgggc
ctggaggagcggcggggcaaagggcgcgcggccgatgagctggaggccggcgccgtcgag
ggcggcgaggagtccggggatggcggtagctcggcagactcgcgctcgggcgtggggccc
ggcgcggtgctgtccctgggcgcctgctgcctggcgttgctgcagatattccgctccaag
aagttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgcctgaaccag
agcagcctcaccatgctcatggccgtgctggtgcttgtgtgcctggtcatgttggccttc
cacgcggcgcggcccccgctccagctgccctacctggccgtgctggcggccgccgtgggc
gtcatcctcatcatggctgtgctctgcaaccgcgccgccttccaccaggaccacatgggc
ctggcctgctatgcgctcatcgccgtggtgctggccgtccaggtggtgggcctgctgctg
ccgcagccgcgcagcgcctctgagggcatctggtggaccgtgttcttcatctacaccatc
tacacgctgctgcccgtgcgcatgcgggccgcggtgctcagcggggtgctcctgtccgcc
ctccacctggtcatcgccctgcgcaccaacgcccaggaccagttcctgctcaagcagctt
gtctccaatgttctcattttctcctgcaccaacatcgtgggtgtctgcacccactaccca
gctgaggtctcccagagacaggctttccaggagacccgagagtgcatccaggcgcggctc
cactcacagcgggagaaccagcagcaggagcggctcttgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccataag
atttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggctttacc
agcctggcatcccagtgcactgcacaggaactggtcatgaccctcaacgagctcttcgcc
cgcttcgacaagctggccgcagagaatcactgtttacgtattaagatccttggggattgt
tattactgcgtctcggggcttcctgaagcaagggctgaccacgcccactgctgcgtggag
atgggcatggacatgatcgaggccatctcgttggtccgggaggtgacgggggtgaacgtg
aacatgcgtgtgggaattcacagcgggcgagtacactgcggtgtccttggtctaaggaag
tggcagttcgacgtctggtctaacgatgttacgctagccaaccacatggaggctggcggc
aaggcgggacgtatccacatcaccaaggctacactcaactacctgaacggggactatgag
gtggagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagacc
ttcctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccatcggacacaacccacctcactggggggctgagcgcccc
ttctacaaccacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaa
gaccccaaggacaagaatgcccaggagagtgcgaaccctgaggatgaagtagatgagttt
ctgggccgcgccattgatgccaggagcattgacaggcttcggtctgagcatgtccgcaag
ttcctcctgaccttcagggagcctgacttagagaagaagtactccaagcaggtagatgac
cgatttggtgcctatgtggcgtgtgcgtcgctcgtcttcctcttcatctgctttgtccag
atcaccatcgtgccccactccgtattcatgctcagcttctacctgacctgttccctgctg
ctgaccttggtggtgtttgtgtctgtgatctactcctgcgtaaagctcttcccctccccg
ctgcagactctctccaggaagatcgtgcggtccaagatgaacagcaccctagttggggtg
ttcaccatcaccctggtgttcctggcggcttttgtcaacatgttcacatgcaactccaag
gacctgctgggctgcttggcactggagcacaacatcagcgcaagccaggtcaacgcatgt
cacgtggcagagtcggccgtcaactacagcctgggtgatgagcagggcttctgtggcagc
ccctggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcaactgcatcgggaagctggcgctcatgctggccatc
gagctcatctacgtgctcatcgtggaggtgccgggtgtcacgctcttcgacaatgccgac
ctgctggtcaccgccaacgccatagacttcttcaacaacgggacctcccagtgccctgag
cacgcaaccaaggtggcattgaaggtggtgacgcccatcatcatctcagtctttgtgctg
gccctgtacctgcatgcccagcaggtggagtccaccgcccgcctcgacttcctctggaaa
ctgcaggccacagaggagaaggaggagatggaggagctgcaggcctacaaccggcggctg
ctgcacaacatcctgcccaaggatgtggccgctcacttcctggcccgcgagcggcgcaac
gatgagctctactatcagtcctgtgagtgcgtggcagtcatgttcgcctccatcgccaac
ttctccgagttctacgttgagctggaggccaacaacgagggtgtcgagtgcctgcggcta
ctcaatgagatcattgctgactttgatgagatcatcagtgaggatcggttccggcagctg
gagaagatcaagaccatcggcagcacctacatggctgcctccggcctcaacgactccacc
tacgacaaggtgggcaagacccacatcaaggcactggccgactttgccatgaagctgatg
gaccagatgaagtacatcaatgagcactctttcaacaacttccagatgaagatcgggctc
aacatcggccccgtggtggccggggtgataggggcacgaaagcctcagtacgacatctgg
ggcaataccgtgaacgtggccagccgcatggacagcactggtgtacccgaccgcatccag
gtcaccacggacatgtaccaggtgctggccgccaacacgtaccaactggagtgccggggc
gtggtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaatggagggcccccg
ctcagttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671165
Entry
104671165         CDS       T03989                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1 isoform X1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05142  Chagas disease
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104671165 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104671165 (ADCY1)
   04371 Apelin signaling pathway
    104671165 (ADCY1)
   04020 Calcium signaling pathway
    104671165 (ADCY1)
   04072 Phospholipase D signaling pathway
    104671165 (ADCY1)
   04024 cAMP signaling pathway
    104671165 (ADCY1)
   04022 cGMP-PKG signaling pathway
    104671165 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104671165 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104671165 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104671165 (ADCY1)
   04062 Chemokine signaling pathway
    104671165 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    104671165 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    104671165 (ADCY1)
   04912 GnRH signaling pathway
    104671165 (ADCY1)
   04913 Ovarian steroidogenesis
    104671165 (ADCY1)
   04915 Estrogen signaling pathway
    104671165 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    104671165 (ADCY1)
   04921 Oxytocin signaling pathway
    104671165 (ADCY1)
   04926 Relaxin signaling pathway
    104671165 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    104671165 (ADCY1)
   04918 Thyroid hormone synthesis
    104671165 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    104671165 (ADCY1)
   04916 Melanogenesis
    104671165 (ADCY1)
   04925 Aldosterone synthesis and secretion
    104671165 (ADCY1)
   04927 Cortisol synthesis and secretion
    104671165 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104671165 (ADCY1)
   04270 Vascular smooth muscle contraction
    104671165 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    104671165 (ADCY1)
   04971 Gastric acid secretion
    104671165 (ADCY1)
   04972 Pancreatic secretion
    104671165 (ADCY1)
   04976 Bile secretion
    104671165 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    104671165 (ADCY1)
   04727 GABAergic synapse
    104671165 (ADCY1)
   04725 Cholinergic synapse
    104671165 (ADCY1)
   04720 Long-term potentiation
    104671165 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    104671165 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104671165 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    104671165 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    104671165 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104671165 (ADCY1)
   04714 Thermogenesis
    104671165 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671165 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    104671165 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104671165 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104671165 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104671165 (ADCY1)
   05163 Human cytomegalovirus infection
    104671165 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104671165 (ADCY1)
   05142 Chagas disease
    104671165 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104671165 (ADCY1)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104671165 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 104671165
NCBI-ProteinID: XP_010372898
LinkDB
Position
6
AA seq 1119 aa
MAGAPRGGGGGGGGAGEPGGAERAAGPSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPAAAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVAVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLASGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGTI
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMGPYGRA
GLQGRRPPVCPMPGVSVRAGLPPHSPGQYLSSAAAGKEA
NT seq 3360 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggcggaggcggcggcggaggcggcgcgggcgagcccgggggc
gccgagcgggcggccgggccaagccgccggcgcgggctccgggcgtgcgacgaggagttc
gcttgcccagagctggaggcgctgttccgcggctacacgctgcggctggagcaggcggcc
acgctgaaggcgctggccgttctcagcctgctggcgggcgcgctggcgctggctgagctg
ctgggcgcgccggggcccgcgcccggcctggccaagggctcgcacccggtgcactgcgtc
ctcttcctggcgctgctcgtggtaaccaacgtccggtccctgcaggtgccccagctgcag
caggtcggccagctggcgctgctcttcagcctcaccttcgcgctgctctgctgtcctttc
gcgctgggcggccccgcccggggttccgccggggccgctggggggccagcggctgccgaa
caaggggtttggcagctccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgc
agcctgctggccatcggctttgggctcgtggtggctgcgtcgcacttgctggtcacagcc
accttggtccccgccaagcgcccacgtctctggaggacgctcggcgccaacgccttgctc
tttgtcggtgtgaacatgtatggggtcttcgtgcggattctgactgagcgttcgcagagg
aaggcgttcctgcaggcccggagctgcattgaggatcgactgaggctggaggatgagaac
gagaagcaggagcggctcctcatgagcctcctgccccggaacgttgccatggagatgaag
gaggacttcctgaagccccctgagaggattttccacaagatttacatccagaggcacgac
aatgtgagcatcctgtttgctgacatcgtgggtttcacgggcttggcatcccagtgcacg
gcccaggagctggtgaaactcctcaatgagctcttcggcaagtttgacgaattagctacg
gagaaccactgtcgtcgcatcaagattctcggggactgctactactgcgtgtcgggactc
acccagcccaagactgaccatgcccactgctgtgtggagatggggctcgacatgattgat
accatcacatccgtggctgaagccactgaggtggacctgaacatgcgcgtgggtctgcac
acgggcagggtcctctgtggtgtcctgggcttgcgcaagtggcagtatgatgtgtggtcc
aatgatgtgaccttggccaatgtcatggaagccgctggcctgccagggaaggttcatatc
acaaagacgaccctagcgtgcttgaatggggactacgaggtagaaccaggttatggacat
gagaggaacagtttcttgaaaactcataacattgaaaccttttttattgtgccatcccat
cgccgaaagatatttccaggcttaattctctcagatataaaaccggccaagaggatgaag
ttcaagactgtctgctacctgctggtgcaactcatgcactgccgaaagatgttcaaggcc
gagatccccttctccaatgtcatgacctgcgaggacgatgacaagcggagggcattgaga
acagcctcagaaaaactcagaaaccgctcatctttttctaccaacgttgtctacaccacc
ccgggcactcgtgtcaacaggtacattagccgcctcttagaagcccgccagacagagctg
gagatggcagacctgaacttctttaccctgaagtacaaacatgtcgaacgggagcaaaag
taccaccagcttcaggacgagtatttcaccagcgctgttgtcctcaccctcatcctggct
gccttatttggccttgtctaccttctgatattcccacagagtgtggccgtcctgctcctg
ctagtattctgcatctgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtc
cagtgttttccagggtgcctgacgattcagattcgcactgtcctgtgtattttcatagtg
gtcttaatctactcagtagcccaaggatgtgtggtgggctgcctgccctgggcctggagc
tccaagcccaacagttccctggtagtccttgcatccgggggccagcgcacagccctgccc
accctgccctgcgagtctacgcaccatgccctgctctgctgcctggtgggcaccctcccg
ctagccatattttttcgggtgtcctccttgccaaaaatgatcctgctgtccgggcttacc
acgtcctacatcctcgtactggagctcagtggatacaccaggactgggggtggtaccatc
tccgggcgcagctatgagccaattgtggccatcctgctcttctcctgtgcgctggccctg
catgccaggcaggtggacatcaggctgaggctggactacctctgggctgcacaggcagag
gaggagcgagaggacatggagaaggtgaagctggacaacaggcgcatcctcttcaacctc
ctgccagcccacgtcgcccagcacttcctcatgtccaaccctcggaacatggacctctac
taccagtcctactcccaggtgggcgtcatgtttgcctccatccccaactttaatgacttc
tacatcgagctggacggcaacaacatgggggtagagtgtctgcggcttctcaacgagatc
attgccgactttgacgagctcatggaaaaagacttttacaaggacatagagaagatcaag
accattgggagcacctacatggctgctgtggggctagcgcctacctcggggaccaaggct
aagaagtccatctcctcccacctgagcacgctggcagactttgccattgagatgtttgac
gttctggatgaaatcaactaccaatcttacaacgactttgtcctccgagttggcatcaat
gttggccccgtggtggctggagtgattggcgctcgcaggccccagtatgacatctgggga
aacacagtcaacgtggccagtcggatggacagcacaggggtccagggcagaatccaggtg
actgaggaagtccaccggctgctgagaagatgcccctaccactttgtgtgccgaggcaaa
gtcagtgtcaagggcaaaggcgagatgttgacatactttctagaaggcaggactgatgga
aacggctcccaaatcaggtccctgggcttggatcggaaaatgggtccatatgggagagct
ggccttcagggcagacgtcccccagtgtgccccatgcctggcgtctcagtcagggctggg
ctccctccacactccccaggccagtatctgtcctctgcagcagctgggaaggaggcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672288
Entry
104672288         CDS       T03989                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104672288 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104672288 (ADCY9)
   04371 Apelin signaling pathway
    104672288 (ADCY9)
   04020 Calcium signaling pathway
    104672288 (ADCY9)
   04072 Phospholipase D signaling pathway
    104672288 (ADCY9)
   04024 cAMP signaling pathway
    104672288 (ADCY9)
   04022 cGMP-PKG signaling pathway
    104672288 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104672288 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104672288 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104672288 (ADCY9)
   04062 Chemokine signaling pathway
    104672288 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    104672288 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    104672288 (ADCY9)
   04912 GnRH signaling pathway
    104672288 (ADCY9)
   04913 Ovarian steroidogenesis
    104672288 (ADCY9)
   04915 Estrogen signaling pathway
    104672288 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    104672288 (ADCY9)
   04921 Oxytocin signaling pathway
    104672288 (ADCY9)
   04926 Relaxin signaling pathway
    104672288 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    104672288 (ADCY9)
   04918 Thyroid hormone synthesis
    104672288 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    104672288 (ADCY9)
   04916 Melanogenesis
    104672288 (ADCY9)
   04925 Aldosterone synthesis and secretion
    104672288 (ADCY9)
   04927 Cortisol synthesis and secretion
    104672288 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104672288 (ADCY9)
   04270 Vascular smooth muscle contraction
    104672288 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    104672288 (ADCY9)
   04971 Gastric acid secretion
    104672288 (ADCY9)
   04972 Pancreatic secretion
    104672288 (ADCY9)
   04976 Bile secretion
    104672288 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104672288 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104672288 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    104672288 (ADCY9)
   04727 GABAergic synapse
    104672288 (ADCY9)
   04725 Cholinergic synapse
    104672288 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    104672288 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104672288 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    104672288 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    104672288 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104672288 (ADCY9)
   04714 Thermogenesis
    104672288 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672288 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    104672288 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104672288 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104672288 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104672288 (ADCY9)
   05163 Human cytomegalovirus infection
    104672288 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104672288 (ADCY9)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104672288 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 104672288
NCBI-ProteinID: XP_010374335
LinkDB
Position
20
AA seq 1372 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATAQPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALPWELLSRALLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGHSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEIIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKVTSSWLLFLSVPLLAHPPKASGGPNPKTQNGLLSPPPEEKLTNSQTSLCEILQEKGR
WAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELER
SYRTSYQEEVIKNSPVKTFASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATTPPPPAAL
AVFSAALLLEVLSLAVSIRMVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVY
SHVTSEFETNIHFPVFTGSAALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCP
DSSVLTSPLDAVQNFSSGRNPCNSSVPHDLRRPASLIGQEVVLVFFLLLLLVWFLNREFE
VSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIF
ASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLN
TAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTK
LLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL
YPKCTDHGVFPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQA
KDAHLSPKRPWKEPVKAEERGRFGRATEKDVCDETGIEEANELTKLNVSKSV
NT seq 4119 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagttgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctccagctgcagcagctccggggattcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtgatggtcgcccccgcgctgtgcttcctcgtggtgtgtgtgggcttcttt
ctgtttactttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctagtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacagccacagcccagcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctttataccgtcatgcactta
cctttgtacctgagcttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgccctgggag
ctgctgagcagggcgctgctccacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggtggggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggggatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagcgcctata
gccttccgccctttcaagatgcagcagatcgaagaagtcagtattttgtttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtccgcccacgccctggtgggtctcctgaac
gatctgttcggtcgctttgaccgcctgtgtgaggaaaccaagtgtgagaaaatcagcact
ctgggagactgttactattgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgcgagtcggggtgcacacgggtaccgtcctgtgcggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccactgcaaaatacttagat
gaccggtacgaaatggaagacgggaaagttatcgaacggctgggccacagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgagatcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcatgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggtaacaagctcatggctgttgttcctgtcagttcctctcctggcgcatcca
cccaaggcttctggaggacctaatcccaaaactcagaacgggcttctgagccctccccca
gaggagaagctcaccaacagtcagacctctctgtgtgagatcttgcaggagaagggaagg
tgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatccgg
gagaaaacggacgcccactttgtggacgtcatcaaagaagacagcctgatgaaagattat
ttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggagctggagcga
tcctacaggaccagctatcaagaagaggtcataaagaactcccccgtgaagacgtttgct
agtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacgctg
tccaccacctgcttcctgaagtacgaggcggccaccacgcctcccccacccgccgccctg
gctgtcttcagcgcggccctgctgctggaggtgctgtccctcgcagtgtccatcaggatg
gtgttcttcctggaggatgtcatggcctgcaccaagcgcctgctggagtggatcgccggc
tggctaccacgtcactgcatcggggccatcctggtgtcgctccccgcactggctgtctac
tcccacgtcacctccgaatttgagacaaacatacacttcccagtgttcacaggctctgcc
gcgctgattgccgttgtgcactactgtaacttctgccagctcagctcctggatgaggtca
tctctcgccaccgttgtgggggccgggccgctgctcctgctctacgtctccctgtgccca
gacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgggaggaac
ccgtgcaatagctcggtgccgcatgacctccggcggccggccagcctcatcggccaggag
gtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaatttgaa
gtcagctaccgtctccactaccatggggacgtggaagcggatcttcaccgcaccaagatc
cagagcatgcgggatcaggcggactggctgctgagaaacatcatcccctaccacgtggct
gagcagctgaaggtgtcccagacctactccaagaaccacgacagcggaggggtgatcttc
gccagcatcgtcaacttcagtgagttctacgaggagaactatgagggtggcaaggagtgc
taccgggtcctcaacgagctcatcggggacttcgatgagctcctaagcaagccggactac
agcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcagggctgaac
accgcgcaggcccaggatggcagccacccacaggagcatctgcagatcctgttcgagttc
gccaaggagatgatgcgggtggtggacgacttcaacagcaacatgctgtggttcaacttc
aagctccgcgtcggcttcaaccacgggcccctcacggccggggtcatcggcaccaccaag
ctgctgtatgacatctggggagacaccgtcaacatcgccagcaggatggacaccaccggc
gtggagtgccgcatccaggtgagcgaagagagctaccgtgtcttgagtaagatgggctac
gacttcgactacagagggaccgtgaacgtcaaggggaaaggccagatgaaaacctacttg
tacccaaagtgcacggaccacggggtcttcccgcagcaccagctgtccatctccccagac
atccgcgtccaggtggatggtagcatcggacggtctcccacagacgagattgccaacctg
gtgccttctgtccagtatgtggacaagacatctctgggttctgacagcagcacgcaggcc
aaggacgcccacctgtcccccaagagaccctggaaggagcccgtcaaagccgaagaaagg
ggtcgatttggcagagccacagagaaagacgtctgtgacgaaacgggaatagaagaagcc
aacgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672569
Entry
104672569         CDS       T03989                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104672569 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104672569 (ADCY7)
   04371 Apelin signaling pathway
    104672569 (ADCY7)
   04020 Calcium signaling pathway
    104672569 (ADCY7)
   04072 Phospholipase D signaling pathway
    104672569 (ADCY7)
   04024 cAMP signaling pathway
    104672569 (ADCY7)
   04022 cGMP-PKG signaling pathway
    104672569 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104672569 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104672569 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104672569 (ADCY7)
   04062 Chemokine signaling pathway
    104672569 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    104672569 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    104672569 (ADCY7)
   04912 GnRH signaling pathway
    104672569 (ADCY7)
   04913 Ovarian steroidogenesis
    104672569 (ADCY7)
   04915 Estrogen signaling pathway
    104672569 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    104672569 (ADCY7)
   04921 Oxytocin signaling pathway
    104672569 (ADCY7)
   04926 Relaxin signaling pathway
    104672569 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    104672569 (ADCY7)
   04918 Thyroid hormone synthesis
    104672569 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    104672569 (ADCY7)
   04916 Melanogenesis
    104672569 (ADCY7)
   04925 Aldosterone synthesis and secretion
    104672569 (ADCY7)
   04927 Cortisol synthesis and secretion
    104672569 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104672569 (ADCY7)
   04270 Vascular smooth muscle contraction
    104672569 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    104672569 (ADCY7)
   04971 Gastric acid secretion
    104672569 (ADCY7)
   04972 Pancreatic secretion
    104672569 (ADCY7)
   04976 Bile secretion
    104672569 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    104672569 (ADCY7)
   04727 GABAergic synapse
    104672569 (ADCY7)
   04725 Cholinergic synapse
    104672569 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    104672569 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104672569 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    104672569 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    104672569 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104672569 (ADCY7)
   04714 Thermogenesis
    104672569 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672569 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    104672569 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104672569 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104672569 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104672569 (ADCY7)
   05163 Human cytomegalovirus infection
    104672569 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104672569 (ADCY7)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104672569 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 104672569
NCBI-ProteinID: XP_030781061
LinkDB
Position
20
AA seq 1095 aa
MPSRPWGLLNGRGWKMPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLTLLLVAATA
CVALIVIAFSQGDPSRHQAILGMAFLALAVFAALTVLMYVECLLRHWLRALALLTWACLV
ALGYVLVFNAWTKAACAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGAL
MGGFTTPSVRVGLQLLANTVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIE
KRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADI
VGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHAR
NCVKMGLDMCQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRM
EAAGVPGRVHITEATLKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQ
HLPRPKGDAALKMRASVRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGRRPKSVPQR
HRRTPDRSMSPKGRSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREY
RLAPIPRARHDFACAGLIFVCILFVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFS
RWCPARGTLCTISERVETQPLLRLTLAILTIGSLLTVAIINLPLMPFPVLELPVGNETGL
PAVSSKTRALCEPLPYYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCW
QWDCCGQGLGNLTEPNGTTSGTPSCSWRDLKTMTNFYLVLFYVTLLMLSRQIDYYCRLDC
LWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASV
PDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSSVEKIKTIGSTYMAAAGLSV
ASGHENQELERQHAHIGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGAR
KPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTY
FVCTDTAKFQGLGLN
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgccctccaggccctggggcctccttaacggccgagggtggaagatgccggccaagggg
cgctacttcctcaacgaaggcgaggagggtcctgaccaagatgcgctctatgagaagtac
cggctcaccagccagcatgggccgcttctgctcacgcttctgctggtggccgccactgcc
tgcgtggccctcatcgtcatcgccttcagccagggggacccctccagacaccaggccatt
ctgggcatggcgttcctggcgctggcggtgtttgcagccctcactgtgctgatgtatgtc
gagtgtctcctgcggcactggctcagggccttggcactgctcacctgggcctgcctggta
gccctgggctacgtgctggtattcaacgcatggacaaaggcggcctgtgcgtgggagcag
gtgcccttcttcctgttcatcgtctttgtggtgtacacgctgctgccgttcagcatgcgg
ggcgctgtcgctgtgggggccgtctccaccgcctcccacctcctggtgctcggtgctttg
atgggaggcttcacgacacccagtgtccgggtggggctgcagctgctggccaacacagtc
atcttcctgtgcgggaacctgacaggcgccttccacaagcaccaaatgcaggatgcgtcc
cgggacctcttcacctacactgtgaagtgcatccagatccgccggaagctgcgcattgag
aagcgccagcaggagaacctgctgctgtcggtgcttccagcccacatctccatgggcatg
aagctggccatcatcgaacggctcaaggagcatggcgaccgccgctgcatgcccgacaac
aacttccacagcctctacgtcaagaggcaccagaatgtcagcatcctctatgcagacatc
gtgggcttcacgcggctggccagcgactgctcccccaaggagttggtggtggtgctgaac
gagctctttggcaagttcgaccagatcgccaaggccaacgagtgcatgcggatcaagatc
cttggtgactgctactactgtgtatcgggcctgcccgtgtcgctgcccacccacgcccgg
aactgtgtgaagatggggctggacatgtgtcaggccatcaagcaggtgcgggaggccacg
ggcgtggacatcaacatgcgtgtgggcatacactcggggaacgtgctgtgtggggtcatc
gggctgcgcaagtggcagtatgacgtgtggtcccacgacgtgtccctggccaaccggatg
gaggcagccggagtccccggtcgggtgcacatcacggaggcgacactgaagcacctggac
aaggcgtatgaggtggaggatgggcacgggcagcagcgggacccctacctcaaggagatg
aacatccgcacctacctggtcatcgaccccaggagccagcagccacccccgcccagccaa
cacctccccagacccaagggggatgcagccctgaagatgcgggcgtcagtgcgcatgacc
cggtacctcgagtcctggggggcagcgcggccgtttgcgcatctcaaccaccgtgagagc
gtgagcagtggcgagacccccgtccccaatgggcggaggcctaagagcgttccccagcgc
caccgccggaccccagataggagcatgtcccccaaggggcggtcggaagatgattcgtac
gatgacgagatgctgtcagccatcgaggggctcagctccacgaggccctgctgctccaag
tctgacgacttctacaccttcgggtccatcttcctggagaagggctttgagcgcgagtac
cgcctggcacccatcccccgggcccgccacgactttgcctgtgccggcctgattttcgtc
tgcatcctgttcgtccacgtcctgctcatgcccaggacggcggcactgggtgtgtccttc
gggctggtggcctgtgtactggggctggtactgggcctgtgctttgccaccaagttctcg
aggtggtgcccagcccgggggacactctgcactatctctgagagggtggagacgcagccc
ctgctgaggctgaccctggccatcctgaccatcggcagcctgctcactgtggctatcatc
aacctgcccctgatgcctttcccagtcctagagctgcctgttggcaatgagacaggccta
ccagccgtgagcagcaagaccagagccctgtgcgagcccctcccgtactatacctgcagc
tgtgtcctgggcttcatcgcctgctccgtcttcctgaggatgagcctggagccaaaggtt
gtgctgctgacagtggccctggtggcctacctggtgctcttcaacctctccccgtgctgg
cagtgggactgctgcggccaaggcctgggcaaccttactgagcccaatggtaccaccagc
ggcacccctagctgttcctggagggacctgaagaccatgaccaatttctacctggtcctg
ttctacgtcaccctgctcatgctctccagacagattgactattactgccgcctggactgt
ctatggaagaagaagttcaagaaggaacacgaggagtttgagaccatggagaacgtgaac
cgccttcttctggagaacgtcctgccagcccatgtggctgcccactttatcggtgacaag
ttaaacgaggactggtaccatcagtcctatgactgcgtctgtgtcatgtttgcctccgtg
ccggacttcaaagtgttttacacagagtgcgatgtcaacaaagaagggctggagtgcctg
cgcctgctcaatgagatcattgccgacttcgacgagctcctgctgaagcccaagttcagc
agcgtggagaagatcaagaccatcggcagcacatacatggcagctgcagggctcagtgtc
gcctcagggcacgagaaccaggagctggagcggcagcacgcccacattggcgtcatggtg
gagttcagcatcgccctgatgagcaagctggacggcatcaacaggcactccttcaactcc
ttccgcctccgcgtcggcataaaccatgggcctgtgattgctggagtgattggggcccga
aaacctcagtatgacatctggggaaacacagtcaacgtggccagccgaatggagagcacc
ggagaacttgggaaaatccaggttaccgaggagacctgcaccatcctccagggcctcgga
tactcttgtgaatgccgtggcctgatcaatgtcaaaggcaaaggcgagctgagaacttac
tttgtctgtacggacactgccaagtttcaggggctggggctgaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674083
Entry
104674083         CDS       T03989                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2 isoform X1
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104674083 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104674083 (ADCY2)
   04371 Apelin signaling pathway
    104674083 (ADCY2)
   04020 Calcium signaling pathway
    104674083 (ADCY2)
   04072 Phospholipase D signaling pathway
    104674083 (ADCY2)
   04024 cAMP signaling pathway
    104674083 (ADCY2)
   04022 cGMP-PKG signaling pathway
    104674083 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104674083 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104674083 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104674083 (ADCY2)
   04062 Chemokine signaling pathway
    104674083 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    104674083 (ADCY2)
   04922 Glucagon signaling pathway
    104674083 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    104674083 (ADCY2)
   04912 GnRH signaling pathway
    104674083 (ADCY2)
   04913 Ovarian steroidogenesis
    104674083 (ADCY2)
   04915 Estrogen signaling pathway
    104674083 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    104674083 (ADCY2)
   04921 Oxytocin signaling pathway
    104674083 (ADCY2)
   04926 Relaxin signaling pathway
    104674083 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    104674083 (ADCY2)
   04918 Thyroid hormone synthesis
    104674083 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    104674083 (ADCY2)
   04916 Melanogenesis
    104674083 (ADCY2)
   04925 Aldosterone synthesis and secretion
    104674083 (ADCY2)
   04927 Cortisol synthesis and secretion
    104674083 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104674083 (ADCY2)
   04270 Vascular smooth muscle contraction
    104674083 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    104674083 (ADCY2)
   04971 Gastric acid secretion
    104674083 (ADCY2)
   04972 Pancreatic secretion
    104674083 (ADCY2)
   04976 Bile secretion
    104674083 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    104674083 (ADCY2)
   04727 GABAergic synapse
    104674083 (ADCY2)
   04725 Cholinergic synapse
    104674083 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    104674083 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104674083 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    104674083 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    104674083 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104674083 (ADCY2)
   04714 Thermogenesis
    104674083 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674083 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    104674083 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104674083 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104674083 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104674083 (ADCY2)
   05163 Human cytomegalovirus infection
    104674083 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104674083 (ADCY2)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104674083 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 104674083
NCBI-ProteinID: XP_010376589
UniProt: A0A2K6P7N2
LinkDB
Position
3
AA seq 1091 aa
MWQQAMRRRRYLRDRAEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
AYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTTIILTMAVFNMFFLSDSEETIPPTANATNTSFS
ASNNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHA
QEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtggcagcaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccgaccgccctggcgattttctttgcgatatttatcctggtctgcatagagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
gcatacctgttcatgtgttttggaggtaccgtctctccctgggaccaggtatcattcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcatt
gcgagtgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaacg
ccgggaggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcgggagcctaccataagcacctcatggaacttgctcttcagcaaacatat
caggacacctgtaattgcatcaagtcccggatcaagttggaatttgaaaaacgtcaacag
gagcggctcctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatc
atccagaggctgcagggccccaaggcaggccagatggagaacacaaataacttccacaac
ctgtacgtgaagcggcataccaacgtgagcatcttatacgctgacattgttggctttacc
cggctggcaagtgactgctccccgggagaactagttcacatgctgaatgagctcttcgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atgggactggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgtgtgggcgtgcattctgggaacgtcctgtgtggcgtgattggtctgcagaag
tggcagtatgatgtgtggtcacatgacgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttccgtcaccctggaacacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tactttgtaatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacaccctcgatggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcagccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaaaagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacaaaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcattc
aagtattacgtgacttgtgcctgcctcatattcttctgtatcttcattgtgcagattctc
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatc
tctctcacgatcatcaccacaaccatcatattaaccatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaactgccaatgcaacaaacacaagcttttca
gcctcaaataatcaggcagcgattctccgtgcgcaaaatttatttttcctcccgtacttt
atctacagctgtattctgggactgatatcctgttctgtgttcctgcgggtgaactacgag
ctgaagatgttgatcatgatggtggcgttggtgggctacaacaccatcctactccacacc
cacgcccacgtcctgggcgactacagccaggtcttgtttgagagaccaggcatttggaaa
gacctgaagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttcta
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgtgtgctgctggagaacgtgctt
cccgcgcacgtcgctgagcacttcctggccaggagcctgaagaatgaggatctataccac
cagtcctatgactgtgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatctgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtgcccagccaggagcatgcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcctttgccctg
gtagcgaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtaggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatc
tggggcaacaccgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaata
caggtcacggaggagacaagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaatgtggcatcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675683
Entry
104675683         CDS       T03989                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104675683 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104675683 (ADCY8)
   04371 Apelin signaling pathway
    104675683 (ADCY8)
   04020 Calcium signaling pathway
    104675683 (ADCY8)
   04072 Phospholipase D signaling pathway
    104675683 (ADCY8)
   04024 cAMP signaling pathway
    104675683 (ADCY8)
   04022 cGMP-PKG signaling pathway
    104675683 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104675683 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104675683 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675683 (ADCY8)
   04062 Chemokine signaling pathway
    104675683 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    104675683 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    104675683 (ADCY8)
   04912 GnRH signaling pathway
    104675683 (ADCY8)
   04913 Ovarian steroidogenesis
    104675683 (ADCY8)
   04915 Estrogen signaling pathway
    104675683 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    104675683 (ADCY8)
   04921 Oxytocin signaling pathway
    104675683 (ADCY8)
   04926 Relaxin signaling pathway
    104675683 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    104675683 (ADCY8)
   04918 Thyroid hormone synthesis
    104675683 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    104675683 (ADCY8)
   04916 Melanogenesis
    104675683 (ADCY8)
   04925 Aldosterone synthesis and secretion
    104675683 (ADCY8)
   04927 Cortisol synthesis and secretion
    104675683 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104675683 (ADCY8)
   04270 Vascular smooth muscle contraction
    104675683 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    104675683 (ADCY8)
   04971 Gastric acid secretion
    104675683 (ADCY8)
   04972 Pancreatic secretion
    104675683 (ADCY8)
   04976 Bile secretion
    104675683 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    104675683 (ADCY8)
   04727 GABAergic synapse
    104675683 (ADCY8)
   04725 Cholinergic synapse
    104675683 (ADCY8)
   04720 Long-term potentiation
    104675683 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    104675683 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    104675683 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    104675683 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    104675683 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    104675683 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104675683 (ADCY8)
   04714 Thermogenesis
    104675683 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675683 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    104675683 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104675683 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104675683 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104675683 (ADCY8)
   05163 Human cytomegalovirus infection
    104675683 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104675683 (ADCY8)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104675683 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 104675683
NCBI-ProteinID: XP_030794046
LinkDB
Position
9
AA seq 1251 aa
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSSS
GSGGSGKASDPAGGGPNHHAPQLAGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDQRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNFNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWEHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcgcttcccggccgcagcggctgttgtggcagacg
gcggtgcggcacatcaccgagcagcgcttcattcacggccaccggggaggcagcagcagc
gggagtggaggctcgggcaaagcctcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctggcaggcgactcggcgctgcccctctactcgctgggcccgggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcgggggcgacctgggcttcctgcaccttgactgtgcccctagcaactcggat
ttctttctcaatgggggctatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatctggaacgcctctaccagcgctatttcttgggccagaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctgcac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtggtgatctgcgccctggtggtggtcaggaaggacaccacctcccacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctggcagca
ggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttcgcc
acctacagcatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcatcccccggctggcggtcatttccatcaaccag
gttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggaaacagagaaccaaagacaggagcggctcgtgctttctgtactcccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagacgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaatgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatt
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaagaaca
aaacacgatgttgacatgaggattggaatccactcaggctcggtgctgtgtggtgttctg
ggactaaggaagtggcagtttgatgtctggtcttgggatgtggacattgcaaacaaactc
gaatctggaggaatccccgggaggattcacatttccaaagccacgctagactgcctcaac
ggtgactataacgtggaagagggtcatggtaaagagaggaatgaattcctgaggaagcat
aatatcgagacttatttaattaagcagcctgaggacagcctgctgtccttgcctgaagat
atcgtcaaggagtcagtgagctcctcagaccagagaaacagtggggccacgttcactgaa
ggatcctggagccctgagctaccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcgttt
atcgttcttctatttatcacggcgatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcggctctggtcctcatcaccaca
gcagaggattataagtgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccatcttgattaatttcctgggtgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggg
gtgttggccatggtgacctgtgcagttttcctccgtctaaactccgtcctgaagctggca
gtgctgctgatcatgattgccatctatgccctgctcactgagaccatctacgcaggcctc
tttctgcgttatgataacttcaaccacagtggagaagatttcctggggaccaaggaggcg
tcgctgctgctgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggatttcctttggcgagtgcaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccacgtggcc
cgccatttcctagagaaggaccgagacaatgaggagctgtattctcaatcctacgatgct
gttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctgaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacctac
atggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaagtgggaacatttg
tgtgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccatggctcagtggtagctggcgtt
attggcgctaagaaaccacagtatgacatttggggcaaaactgtgaacctggcaagccga
atggacagcacaggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatctatgtgaagggcatcagtgaa
caggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactgcctgggcagtactccctggctgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacgggaatc
atcaagggtcattataaccggcggactttgttgtcacccagcgggacggagcctggagcc
caagctgaaggcactgacaaatctgatttgccataa

DBGET integrated database retrieval system