KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654910
Entry
104654910         CDS       T03989                                 

Gene name
EDN2
Definition
(RefSeq) endothelin-2
  KO
K16367  endothelin-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04270  Vascular smooth muscle contraction
rro04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104654910 (EDN2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104654910 (EDN2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104654910 (EDN2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104654910 (EDN2)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 104654910
NCBI-ProteinID: XP_010352547
UniProt: A0A2K6PFM3
LinkDB
Position
12
AA seq 178 aa
MISMPTTWCSVALALLVALHEGKGQAAATLEQPASSPHAQGTHLRLRRCSCSSWLDKECV
YFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEARA
VPSRKSPADVFQTGKTRATTEELLQRLRDISTVKSLLAKRQQEAMREPRPTHSRWRKR
NT seq 537 nt   +upstreamnt  +downstreamnt
atgatctccatgcccaccacctggtgctctgttgcactagccctgctcgtggccctgcat
gaagggaagggccaggctgctgccaccctggagcagccagcatcctcacctcatgcccaa
ggcacccacctgcggcttcgccgttgctcctgcagctcctggctcgacaaggagtgcgtc
tacttctgccacttggacatcatctgggtgaacactcctgaacagacagctccttacggc
ctgggaaacccgccaagacgccggcgccgctccctgccaaggcgctgtcagtgctccagc
gccagggaccctgcctgtgccaccttctgccttcgaaggccctggactgaagcccgggca
gtcccaagccggaagtcccctgcagacgtgttccagactggcaagacaagggccactaca
gaagagcttctccaaaggctgagggacatttccacagtcaagagcctccttgccaagcga
cagcaggaggcgatgcgggagccgcggcccacacactccaggtggaggaagagatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657358
Entry
104657358         CDS       T03989                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1
  KO
K16366  endothelin-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04270  Vascular smooth muscle contraction
rro04668  TNF signaling pathway
rro04916  Melanogenesis
rro04924  Renin secretion
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05200  Pathways in cancer
rro05410  Hypertrophic cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104657358 (EDN1)
   04066 HIF-1 signaling pathway
    104657358 (EDN1)
   04024 cAMP signaling pathway
    104657358 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104657358 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104657358 (EDN1)
   04916 Melanogenesis
    104657358 (EDN1)
   04924 Renin secretion
    104657358 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104657358 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657358 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104657358 (EDN1)
   05410 Hypertrophic cardiomyopathy
    104657358 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104657358 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 104657358
NCBI-ProteinID: XP_010355444
UniProt: A0A2K6NTX3
LinkDB
Position
4
AA seq 211 aa
MDYLLMIFSLLFVAFQGAPETAVLGAELSTVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
KFCQAGKELRAEDTMEKAWNNHKKGKDCPKLGKKCIYQQLVRGRKIGSSEEHLRQTRTET
MRNSVKSSFHDPRLKAKPSREHYVTHNRAHW
NT seq 636 nt   +upstreamnt  +downstreamnt
atggattatttgctcatgattttctctctgctgtttgtggctttccaaggagctccagaa
acagcggtcttaggcgctgagctcagcacggtgggtgagaacggcggggagaaacccact
cccagcccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggat
aaagagtgtgtctacttctgccacttggacatcatttgggtcaacactcccgagcacgtt
gttccatatggactgggaagccctaggtccaaacgagccttggagaatttacttcccaca
aaggcaacagaccgtgagaatagatgccaatgtgctagccaaaaagacaagaagtgctgg
aagttttgccaagcaggaaaagaactcagggccgaagacactatggagaaagcctggaat
aaccataagaaaggaaaagactgtcccaagcttgggaaaaagtgtatttatcagcagtta
gtgagaggaagaaaaatcggaagttcagaagaacacctaagacaaaccaggacggagacc
atgagaaacagtgtcaaatcatcttttcatgatcccaggctgaaagccaagccctccaga
gagcattatgtgacccacaaccgagcacattggtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663806
Entry
104663806         CDS       T03989                                 

Gene name
EDN3
Definition
(RefSeq) endothelin-3 isoform X3
  KO
K05227  endothelin-3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04270  Vascular smooth muscle contraction
rro04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104663806 (EDN3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104663806 (EDN3)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104663806 (EDN3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104663806 (EDN3)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 104663806
NCBI-ProteinID: XP_010363462
LinkDB
Position
13
AA seq 230 aa
MEPGLWLLFGLTVTSAAGLVPCSQSGDAGRRGVSQVPTAARSEGDCEETVAGPGEGTVAP
TALQGPSPGSPGQEQVAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYG
LSNYRGSFRGKRSAGLLPGNLQLSHRPHSRCACVGRSDKACLHFCTQTLDVSSHSRTAEK
TDKEEEGKVEVKDRQSKQALDLQHPKLVPGSGLALGPSTCPRCLFQEGAP
NT seq 693 nt   +upstreamnt  +downstreamnt
atggagccggggctgtggctccttttcgggctcacagtgacctccgccgcaggattggtg
ccttgctcccagtctggggatgctggcaggcgcggcgtgtcccaggtccccactgcagcc
agatctgagggcgactgtgaagagactgtggctggccctggtgaggggactgtggccccg
acagcactgcagggtccaagccctggaagtcctgggcaggagcaggtggccgagggggcc
cctgagcaccaccgatccaggcgctgcacgtgcttcacctacaaggacaaggagtgtgtc
tactattgccacctggacatcatttggatcaacactcccgaacagaccgtgccctatgga
ctgtccaactacagaggaagcttccggggcaagaggtctgcggggctgcttccggggaac
ctgcagctctcgcatcgaccacactcgcgctgcgcttgtgtggggagatctgacaaggcc
tgcctgcacttttgcacccaaactttggacgtcagcagtcattcaaggacggcagaaaaa
acagacaaagaagaggaagggaaggttgaagtcaaggacagacaaagcaagcaggcttta
gacctccagcatccaaagctcgtgcccggcagtggactcgccctcggtccatctacctgc
ccccgctgcctctttcaggaaggagccccttag

DBGET integrated database retrieval system