KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654953
Entry
104654953         CDS       T03989                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04145  Phagosome
rro04210  Apoptosis
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04810  Regulation of actin cytoskeleton
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04971  Gastric acid secretion
rro05014  Amyotrophic lateral sclerosis
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05164  Influenza A
rro05205  Proteoglycans in cancer
rro05225  Hepatocellular carcinoma
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104654953 (ACTG1)
   04390 Hippo signaling pathway
    104654953 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104654953 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    104654953 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104654953 (ACTG1)
   04520 Adherens junction
    104654953 (ACTG1)
   04530 Tight junction
    104654953 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104654953 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104654953 (ACTG1)
   04613 Neutrophil extracellular trap formation
    104654953 (ACTG1)
   04670 Leukocyte transendothelial migration
    104654953 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104654953 (ACTG1)
   04919 Thyroid hormone signaling pathway
    104654953 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    104654953 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    104654953 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104654953 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104654953 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104654953 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104654953 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    104654953 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104654953 (ACTG1)
   05414 Dilated cardiomyopathy
    104654953 (ACTG1)
   05416 Viral myocarditis
    104654953 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104654953 (ACTG1)
   05135 Yersinia infection
    104654953 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    104654953 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    104654953 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rro03021]
    104654953 (ACTG1)
   03019 Messenger RNA biogenesis [BR:rro03019]
    104654953 (ACTG1)
   03036 Chromosome and associated proteins [BR:rro03036]
    104654953 (ACTG1)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104654953 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104654953 (ACTG1)
   04147 Exosome [BR:rro04147]
    104654953 (ACTG1)
Transcription machinery [BR:rro03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     104654953 (ACTG1)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     104654953 (ACTG1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     104654953 (ACTG1)
    NuA4 complex
     104654953 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    104654953 (ACTG1)
   PBAF complex
    104654953 (ACTG1)
   SWR1 complex
    104654953 (ACTG1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    104654953 (ACTG1)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     104654953 (ACTG1)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104654953 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 104654953
NCBI-ProteinID: XP_030779663
LinkDB
Position
19
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagagatcgccgcgctggtcattgacaatggctccggcatgtgcaaagctggc
tttgctggggacgatgcaccccgagccgtgtttccctccatcgtcgggcgtccccgacac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggtgacgaggcccagagc
aagcgcggcatcttgaccctgaagtaccctatcgagcatggcattgtcaccaactgggat
gacatggagaaaatctggcaccatactttctacaatgagctgcgcgtagccccagaggag
cacccggtgctgctgaccgaggcccccctgaaccctaaggccaacagagagaagatgact
cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg
tccctctacgcctctgggcgcaccactggcattgtcatggactctggagacggggtcacc
cacacggtgcccatctatgagggctacgctctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgtggctacagcttc
accaccaccgccgagcgggaaattgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccaccgccgcatcgtcctcttccctggagaagagctac
gagctgcctgatggccaggtcatcaccatcggcaatgagcggttccggtgtccggaggca
ttgttccagccttctttcctgggcatggaatcttgcggcatccatgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtatgccaacacggtgctgtct
ggcggtaccaccatgtacccaggcattgccgacaggatgcagaaagagatcactgccctg
gcacccagcaccatgaagatcaagatcatcgcacccccagaacgcaagtactcagtgtgg
atcggtggctccatcttggcctcactgtccaccttccagcagatgtggattagcaagcag
gagtacgacgagtcgggcccctccatcgtccatcgcaaatgcttctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665228
Entry
104665228         CDS       T03989                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04145  Phagosome
rro04210  Apoptosis
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04810  Regulation of actin cytoskeleton
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04971  Gastric acid secretion
rro05014  Amyotrophic lateral sclerosis
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05164  Influenza A
rro05205  Proteoglycans in cancer
rro05225  Hepatocellular carcinoma
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104665228 (ACTB)
   04390 Hippo signaling pathway
    104665228 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104665228 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    104665228 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104665228 (ACTB)
   04520 Adherens junction
    104665228 (ACTB)
   04530 Tight junction
    104665228 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104665228 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104665228 (ACTB)
   04613 Neutrophil extracellular trap formation
    104665228 (ACTB)
   04670 Leukocyte transendothelial migration
    104665228 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104665228 (ACTB)
   04919 Thyroid hormone signaling pathway
    104665228 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    104665228 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    104665228 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104665228 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104665228 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104665228 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104665228 (ACTB)
   05410 Hypertrophic cardiomyopathy
    104665228 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104665228 (ACTB)
   05414 Dilated cardiomyopathy
    104665228 (ACTB)
   05416 Viral myocarditis
    104665228 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104665228 (ACTB)
   05135 Yersinia infection
    104665228 (ACTB)
   05100 Bacterial invasion of epithelial cells
    104665228 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    104665228 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rro03021]
    104665228 (ACTB)
   03019 Messenger RNA biogenesis [BR:rro03019]
    104665228 (ACTB)
   03036 Chromosome and associated proteins [BR:rro03036]
    104665228 (ACTB)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104665228 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104665228 (ACTB)
   04147 Exosome [BR:rro04147]
    104665228 (ACTB)
Transcription machinery [BR:rro03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     104665228 (ACTB)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     104665228 (ACTB)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     104665228 (ACTB)
    NuA4 complex
     104665228 (ACTB)
  Chromatin remodeling factors
   BAF complex
    104665228 (ACTB)
   PBAF complex
    104665228 (ACTB)
   SWR1 complex
    104665228 (ACTB)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    104665228 (ACTB)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     104665228 (ACTB)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104665228 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 104665228
NCBI-ProteinID: XP_030788090
LinkDB
Position
6
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatatcgccgcgctcgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggattcatatgtgggcgatgaggcccagagc
aagagaggcatcctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgact
cagatcatgtttgagaccttcaacactccagccatgtacgtggccatccaggctgtgctg
tccctgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcactgagcgcggctacagtttc
accaccacggccgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccacggcggcttccagctcctccctggagaagagctac
gagctgcccgatggccaggtcatcaccattggcaacgagcggttccgctgccctgaggct
ctcttccagccttcttttctgggcatggagtcctgtggcatccatgaaactaccttcaac
tccatcatgaagtgtgacgtggacatccgtaaagacctgtatgccaacacagtgctgtct
ggtggcaccaccatgtaccctggcattgctgacaggatgcagaaggagattactgccctg
gcgcccagcacgatgaaaatcaagattattgctcctcctgagcgcaagtactccgtgtgg
attggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtctggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system