KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654979
Entry
104654979         CDS       T03989                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04650  Natural killer cell mediated cytotoxicity
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
rro05416  Viral myocarditis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104654979 (RAC3)
   04014 Ras signaling pathway
    104654979 (RAC3)
   04015 Rap1 signaling pathway
    104654979 (RAC3)
   04310 Wnt signaling pathway
    104654979 (RAC3)
   04370 VEGF signaling pathway
    104654979 (RAC3)
   04071 Sphingolipid signaling pathway
    104654979 (RAC3)
   04024 cAMP signaling pathway
    104654979 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104654979 (RAC3)
   04520 Adherens junction
    104654979 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104654979 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104654979 (RAC3)
   04662 B cell receptor signaling pathway
    104654979 (RAC3)
   04664 Fc epsilon RI signaling pathway
    104654979 (RAC3)
   04062 Chemokine signaling pathway
    104654979 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    104654979 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654979 (RAC3)
   05231 Choline metabolism in cancer
    104654979 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104654979 (RAC3)
   05212 Pancreatic cancer
    104654979 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104654979 (RAC3)
   05416 Viral myocarditis
    104654979 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104654979 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104654979 (RAC3)
   05163 Human cytomegalovirus infection
    104654979 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    104654979 (RAC3)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    104654979 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 104654979
NCBI-ProteinID: XP_010352637
LinkDB
Position
19
AA seq 254 aa
MLGALRPHSPPQPPEPGLPWSSSSPRSPRIWWAGTPVSTPDTLTRLWLLGRGLPLLGRGS
EAGPGSHVACPVRSAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDT
AGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLD
LRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLC
PPPVKKPGKKCTVF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgttgggcgccctgcgcccccattcaccaccccagcccccggagcccggcctgccctgg
tcgtcctccagccctaggtcgccgcggatctggtgggctgggacccccgtctccacccca
gacaccctaactcgcctctggctgctggggaggggtttgcccttgttgggcagagggtcc
gaggccgggcctgggagccacgtggcttgccctgtccgcagcgccgtggggaagacatgc
ttgctgatcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgac
aactactcggccaacgtgatggtggacgggaagccggtcaacctggggctgtgggacacg
gcggggcaggaggactatgatcggctgcggccactttcctacccccaaactgacgtcttt
ctgatctgcttctccctggtgagcccggcctcctttgagaacgttcgtgccaagtggtac
ccggaggtgcggcaccactgcccccacacacccatcctcctggtgggcaccaagctggac
ctccgcgacgacaaggacaccattgagcggctgcgggacaagaagctggcgcccatcacc
tacccacagggcctggccatggcccgggagattggctctgtgaagtacctggagtgctca
gccctgacccagcggggcctgaagacagtgtttgacgaggcaatccgcgcagtgctctgc
ccgcccccagtgaagaagccagggaagaagtgcacggtcttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665823
Entry
104665823         CDS       T03989                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04810  Regulation of actin cytoskeleton
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04972  Pancreatic secretion
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
rro05416  Viral myocarditis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104665823 (RAC1)
   04014 Ras signaling pathway
    104665823 (RAC1)
   04015 Rap1 signaling pathway
    104665823 (RAC1)
   04310 Wnt signaling pathway
    104665823 (RAC1)
   04370 VEGF signaling pathway
    104665823 (RAC1)
   04071 Sphingolipid signaling pathway
    104665823 (RAC1)
   04024 cAMP signaling pathway
    104665823 (RAC1)
   04151 PI3K-Akt signaling pathway
    104665823 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104665823 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104665823 (RAC1)
   04520 Adherens junction
    104665823 (RAC1)
   04530 Tight junction
    104665823 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104665823 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104665823 (RAC1)
   04620 Toll-like receptor signaling pathway
    104665823 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    104665823 (RAC1)
   04662 B cell receptor signaling pathway
    104665823 (RAC1)
   04664 Fc epsilon RI signaling pathway
    104665823 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    104665823 (RAC1)
   04670 Leukocyte transendothelial migration
    104665823 (RAC1)
   04062 Chemokine signaling pathway
    104665823 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    104665823 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104665823 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    104665823 (RAC1)
   04380 Osteoclast differentiation
    104665823 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665823 (RAC1)
   05205 Proteoglycans in cancer
    104665823 (RAC1)
   05203 Viral carcinogenesis
    104665823 (RAC1)
   05231 Choline metabolism in cancer
    104665823 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104665823 (RAC1)
   05212 Pancreatic cancer
    104665823 (RAC1)
   05211 Renal cell carcinoma
    104665823 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104665823 (RAC1)
   05020 Prion disease
    104665823 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    104665823 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104665823 (RAC1)
   05416 Viral myocarditis
    104665823 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104665823 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104665823 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104665823 (RAC1)
   05135 Yersinia infection
    104665823 (RAC1)
   05100 Bacterial invasion of epithelial cells
    104665823 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104665823 (RAC1)
   05163 Human cytomegalovirus infection
    104665823 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104665823 (RAC1)
   05169 Epstein-Barr virus infection
    104665823 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104665823 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104665823 (RAC1)
   04031 GTP-binding proteins [BR:rro04031]
    104665823 (RAC1)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    104665823 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    104665823 (RAC1)
  Macropinocytosis
   Ras GTPases
    104665823 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    104665823 (RAC1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104665823 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   104665823 (RAC1)
  Exosomal proteins of colorectal cancer cells
   104665823 (RAC1)
  Exosomal proteins of bladder cancer cells
   104665823 (RAC1)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    104665823 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 104665823
NCBI-ProteinID: XP_010366046
UniProt: A0A2K6RLD0
LinkDB
Position
6
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattac
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgattgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtgaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccacct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682502
Entry
104682502         CDS       T03989                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04613  Neutrophil extracellular trap formation
rro04650  Natural killer cell mediated cytotoxicity
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro05020  Prion disease
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
rro05416  Viral myocarditis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104682502 (RAC2)
   04014 Ras signaling pathway
    104682502 (RAC2)
   04015 Rap1 signaling pathway
    104682502 (RAC2)
   04310 Wnt signaling pathway
    104682502 (RAC2)
   04370 VEGF signaling pathway
    104682502 (RAC2)
   04071 Sphingolipid signaling pathway
    104682502 (RAC2)
   04024 cAMP signaling pathway
    104682502 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104682502 (RAC2)
   04520 Adherens junction
    104682502 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104682502 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104682502 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    104682502 (RAC2)
   04662 B cell receptor signaling pathway
    104682502 (RAC2)
   04664 Fc epsilon RI signaling pathway
    104682502 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    104682502 (RAC2)
   04670 Leukocyte transendothelial migration
    104682502 (RAC2)
   04062 Chemokine signaling pathway
    104682502 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    104682502 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682502 (RAC2)
   05231 Choline metabolism in cancer
    104682502 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104682502 (RAC2)
   05212 Pancreatic cancer
    104682502 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    104682502 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104682502 (RAC2)
   05416 Viral myocarditis
    104682502 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104682502 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104682502 (RAC2)
   05163 Human cytomegalovirus infection
    104682502 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    104682502 (RAC2)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    104682502 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 104682502
NCBI-ProteinID: XP_010387500
UniProt: A0A2K6REW4
LinkDB
Position
13
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQHKRACSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgccttccccggagagtacatccccaccgtgtttgacaactat
tcagccaacgtgatggtggacagcaagccggtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccactctcctacccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcctatgagaacgtccgcgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gatgacaaggacaccatcgagaaactgaaggagaagaagctggctccgatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatatctggagtgctcagccctc
acccagagaggcctgaaaaccgtgttcgacgaagccatccgggccgtgctgtgccctcag
cccacgcggcagcataagcgcgcctgtagcctcctctag

DBGET integrated database retrieval system