KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654984Help
Entry
104654984         CDS       T03989                                 

Gene name
FASN
Definition
(RefSeq) fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00061  Fatty acid biosynthesis
rro01100  Metabolic pathways
rro01212  Fatty acid metabolism
rro04152  AMPK signaling pathway
rro04910  Insulin signaling pathway
Module
rro_M00082  Fatty acid biosynthesis, initiation
rro_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104654984 (FASN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104654984 (FASN)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104654984 (FASN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rro01004]
    104654984 (FASN)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104654984 (FASN)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     104654984 (FASN)
Lipid biosynthesis proteins [BR:rro01004]
 Fatty acid synthase
  Animal type
   104654984 (FASN)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104654984 (FASN)
  Exosomal proteins of breast milk
   104654984 (FASN)
  Exosomal proteins of colorectal cancer cells
   104654984 (FASN)
  Exosomal proteins of bladder cancer cells
   104654984 (FASN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Thioesterase KR Ketoacyl-synt_C KAsynt_C_assoc ADH_zinc_N PS-DH ADH_zinc_N_2 PP-binding Methyltransf_12 adh_short Methyltransf_31 Thiolase_N Methyltransf_11 Methyltransf_23 YjeF_N adh_short_C2 PE-PPE ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 104654984
NCBI-ProteinID: XP_010352652
LinkDB All DBs
Position
19
AA seq 2510 aa AA seqDB search
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDAGINPASLRGTHTGVWVGVSGSEASEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSMVALQSAYQAISSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDAEGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGCKEQGVTFPSGEAQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPVSGLAALAKVLLSLEHGLWAPNLHFH
SPHPEIPALLDGRLQVVAQPLPVRGGNVGINSFGFGGSNVHVILRPHTQPPPAPAPHASL
PRLLRASGRTPEAVQELLEQGLQHSQELAFLSMLNDIAAVPTTAMPFRGYAVLGGEQGDP
EVQQVPAGNRPLWFICSGMGTQWRGMGLSLMRLDHFRDSILRSDEAVKPFGLKVSQLLLS
TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPLGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQASVFE
FMEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQALKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPGCT
IIPLMKKDHRDNLEFFLTGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSPSAAIYNIDTSPESPDHYLVDHTIDGRCIFPATGYLCIVWKTLA
RALGLAVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSQNGNLIVSGKVYQ
WEDPDPKLFNHPESPTPSPEEPLFLTQAEVYKELRLRGYDYGPHFHGILEARLEGDSGRL
LWKDNWVSFLDAMLQISILGLAKRSLHLPTRITAIHIDPATHRQKLYTLQDNAQVADVVV
SRWLSITVAGGVHMSRVHTESAPRRQQDLQVPILEKFCFTPHVEEGCLSERAALQKELQL
CKGLVQALQTKVTQQGLRMVVPGLDGAQVPQDPPQQGLPQLLSAACRLQLNGNLQLELAQ
VLAQKRPELPEDPLLSGLLDSPALRACLDTAVENMPSRKMKVVEVLAGHGHLYSRIPGLL
GTQPLLQLSYTATDRHPQALKAAEAELQQHDIAQGQWDPADPAPSSLGSTDLLVCNCAVA
ALGDPASALSNMVATLREGGFLLLHTLLRGHPLGETVAFLTSAEPQYGQGILSQDAWESL
FSSVSLRLVGLKKSFYGSALFLCRRPAPQDSPIFLPVDDTSFCWVESLKGILADEDSSRP
VWLKAVNCATSGVVGLVNCLRQEPGGHRLRCVLLSNLSSASRVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVTTLTRGDLSSIRWVCSSLRHAQPSRPG
AQLCTVYYASLNFRDIMLATGKLSPEAIPGKWASQDNLLGMEFSGRDPTGKRVMGLVPAE
GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYCTAYYSLVVRGRVRPGETVLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSSEKRAYLQARFPQLDSTSFANSRDTSFEQHVLRHTGGKG
VDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGILLDALL
EGSAEWQEVAALLQAGIREGVVQPLKCTVFPGAQVEDAFRYMAQGKHIGKVLVQVLAEEP
EAVLKGAKPTLMSAISKTFCPAYKSYIIAGGLGGLGLELAQWLIQRGAQKLVLTSRSGVR
TGYQAKQVRQWRRQGVQVLVSTSNISSLEGARGLIAEAAQLGPVGGIFNLTMVLRDAMLE
NQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSSGRGNAGQSNYGFANSAM
ERICEKRRHEGLPGLAVQWGAIGDVGILADTVNINATVIGGTLPQRVASCLEVLDLFLNQ
PHMVLSSFVLAEKAAAYRDRDGEQDLVKAVAHILGIRDLAAVNLDSSLADLGLDSLMSVE
VRQTLEHKLNLVLSMREVRQLTLRKLQELSLKADAANELASPTPKEDGLTRQQTQLNLRS
LLVNPEGPTLMQLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDS
IHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSH
TYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNKVLEALLPLKGLEERVAAAV
DLIIKSHQGLDRQELSFAALSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGAD
YNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIVSIIHSSLAEPRVSVREG
NT seq 7533 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtggtgattgccggtatgtccgggaagctgccggagtcggagaacttgcag
gagttctgggacaacctcatcggcggcgtggacatggttacggacgatgaccgtcgctgg
aaggcggggctctatggactgccccgacggtccggcaaactgaaggacctgtctaggttc
gatgcttccttctttggagtccaccccaagcaggcacacaccatggaccctcagctgcgg
ctgctgctggaagtcacctatgaggccatcgtggacgcaggcatcaacccagcttcactc
cgagggacacacactggcgtttgggtgggcgtgagcggctctgaggcctcggaggccctg
agccgagaccctgagacgctcgtgggctacagcatggtgggctgccagcgagccatgatg
gccaaccggctctccttcttcttcgacttcaaagggcccagcatcgccctggacacggcc
tgctcctccagcatggtggccctgcagagcgcctaccaggccatctccagcgggcaatgc
cctgctgccatcgtggggggcatcaatgtcctgctgaagcccaacacctctgtgcagttc
ctgcggctggggatgctgagccccgagggcacctgcaaggccttcgacgcagaggggaac
gggtactgccgctcggagggtgtggtggccgtcctgctgaccaagaagtccctggcccgg
cgggtatacgccaccatcctgaatgctggcaccaatacagatggctgcaaggagcaaggc
gtgaccttcccctctggagaggcccaggagcagctcatccgttccttgtaccagtcggct
ggagtggcccctgagtcatttgagtacatcgaagcccacggcacaggcaccaaggtgggt
gacccccaggagctgaatggcatcacccgagccctgtgcgccacccgccaggagccactg
ctcattggctccaccaagtccaacatggggcacccggagccagtctcggggctggcagcc
ttggccaaggtgctgctgtccctggagcacgggctctgggcccccaacctgcacttccac
agcccccaccctgagatcccagcgctgttggatgggcggctgcaagtggtggcccagccc
ctgcccgtccgtggtggcaacgtgggcatcaactcctttggctttgggggctccaatgtg
cacgtcatcctgaggccccacacgcagccacccccagcacccgccccacacgccagcctg
ccccgtctgctgcgggctagtggacgcacccctgaggctgtgcaggagctgctggagcag
ggcctccagcacagccaggagctggctttcctgagcatgctgaacgacatcgcggccgtc
cccaccacggccatgcccttccgtggctatgccgtgctgggtggcgagcagggtgaccca
gaggtgcagcaggtgcccgctggcaaccgcccactctggttcatctgctctgggatgggc
acgcagtggcgcgggatggggctgagcctcatgcgcctggaccacttccgagactccatc
ctgcgctccgatgaggctgtgaagccgttcggcctgaaggtgtcacagctgcttctgagc
acggacgagagcacctttgatgacatcgtccactccttcgtgagcctgactgccatccag
ataggtctcatagacctgctgagctgcatggggctgagaccagatggcatcgttggccac
tctctgggggaggtggcctgtggctacgctgacggctgcctgtcccaggaggaggctgtc
ctcgctgcctactggaggggccaatgcatcaaagaagcgcatctcccactgggcgccatg
gcagccgtgggcttgtcctgggaggagtgtaaacagcgctgccccccgggcgtggtgccc
gcctgccacaactccaaggacacagtcaccatctcgggacctcaggcctctgtgtttgag
ttcatggagcagctgaggaaggagggtgtgtttgccaaggaggttcggaccggcggtatg
gccttccactcctacttcatggaggccatcgcacccccactactgcaggcgctcaagaag
gtgatccgggagccgaagccacgttcagcccgctggctcagcacctccatccctgaggcc
cagtggcacagcagcctggcacgcacgtcctccgctgagtacaatgtcaacaacctggtg
agccctgtgctgttccaggaggccctgtggcacgtgcctgagcacgcagtggtgctggag
atcgcaccccatgccctgctgcaggctgtcctgaagcgtggcctgaagccgggctgcacc
atcatccccctgatgaaaaaggatcacagagacaacctggagttcttcctcaccggcatc
ggcaggctgcacctctcaggcatcgacgccaaccccaatgccttgttcccgcctgtggag
ttcccagctccccgaggaacccccctcatctccccactcatcaaatgggaccacagcctg
gcctgggacgtgccggctgccgaggatttccccaacggctctggttccccctcggccgcc
atctacaacattgacaccagccccgagtctcccgaccactacctggtggatcacaccatc
gacggccgatgcatcttccccgccactggctacctgtgcatagtgtggaagacgctggcc
cgggccctgggcctggccgtggagcagctgcctgtggtgtttgaggacgtggtgctacac
caggccaccatcctgcccaagactgggaccgtgtccctggaagtacggctcctggaggcc
tcccgcgcctttgaggtgtcacagaacggcaacctgatagtgagtgggaaggtgtaccag
tgggaggaccctgaccccaagctcttcaaccacccggaaagtcccacccccagccccgag
gagccccttttcctgacccaggctgaggtttacaaggagctgcgtctgcgtggctacgac
tatggccctcacttccatggcatcctggaggcccgcctggaaggtgactcggggaggctg
ctgtggaaggacaactgggtgagcttcctggacgccatgctgcagatatccatcctgggc
ttggccaagcgcagcctgcacctgcccacccgcatcaccgccatccacatcgaccctgcc
acccataggcagaagctatacacgctgcaggacaacgcccaagtggctgacgtggtggtg
agcaggtggctgagcatcacggtggccggaggcgtccacatgtcccgtgtccacactgag
tcggccccgcggcggcagcaggacctgcaggtgcccatcctggagaagttttgcttcacg
ccgcacgtggaggaggggtgcctgtctgagcgcgccgccctgcagaaggagctgcagctg
tgcaaaggactggtgcaggcactgcagaccaaggtgacccagcaggggctgagaatggtg
gtgcccggactggacggggcccaggtcccccaggaccccccacagcagggactgccccag
ctgctgtcggctgcatgcaggcttcagctcaacgggaacctgcagctggagctagcgcag
gtgctggcccagaagaggcccgagctgccagaggaccctctgctcagcggccttctggac
tccccagcgctcagggcctgcctggacactgccgtggagaacatgcccagccggaagatg
aaggtggtggaggtgctggctggccacggtcacctgtattcccgcatcccaggcctgctt
ggcacccagcccctgctgcagctgagctacacggccaccgatcgccaccctcaggccctg
aaggctgccgaggccgagctgcagcagcacgacattgcccagggccagtgggaccctgcg
gaccctgcccccagctccctgggcagcactgacctcctggtgtgcaactgtgctgtggct
gcccttggggacccggcctcagctctcagcaacatggtggctaccctgagagaagggggc
ttcctgctgctgcacacactgctccgggggcaccccctcggggagaccgtggccttcctc
acctccgctgaacctcagtatggccagggcatcctgagccaggacgcgtgggagagcctc
ttctccagtgtgtcgctgcgcctggtgggcctgaagaagtccttctacgggtctgcactc
ttcctgtgccgccggcccgccccgcaggacagccccatcttcctgccagtggacgacacc
agcttctgctgggtggagtcgctgaagggcatcctggctgacgaagactcctcccggccc
gtgtggctgaaggccgtcaactgtgccacctcgggcgtggtgggcttggtcaactgtctc
cgccaagagcccggcgggcaccgcctccggtgcgtgctgctctccaacctcagcagcgcc
tctcgcgtcccggaggtggacccgggctccgcagagctgcaaaaggtgttgcagggagac
ctggtgatgaacgtctaccgcgacggggcttggggggccttccgccacttcctgctggag
gaggacaagcctgaggagccgacagcacacgcctttgtgaccaccctcaccaggggggac
ctgtcctccatccgctgggtctgctcctccctgcgccatgcccagccctcccgccccggc
gcccagctctgcacggtctactacgcctccctcaacttccgcgacatcatgctggccacc
ggcaagctgtcccctgaggccattccagggaagtgggcctcccaggacaacctgctaggc
atggagttctcaggccgagaccccactggcaagcgtgtgatgggattggtgcccgccgag
ggcctggccacctctgtcctgctgtcaccagactttctctgggacgtgccatccaactgg
accctggaggaggcggcctcagtgcccgtcgtctactgcacagcctactactcgctggtg
gtgcgcgggcgggtgcgccctggggagacagtgcttatccactcgggctccggtggcgtg
ggccaggccgccatcgccatcgcccttagtctaggctgccgcgtcttcaccaccgtgggg
tcgtccgagaagcgggcgtacctccaggccaggttcccccagctggacagcaccagcttc
gccaactcccgggacacatcgttcgagcagcatgtcctgcggcacacgggcgggaagggt
gttgacctggtcctgaactccttggcggaagagaagctgcaggccagcgtgaggtgcttg
gctcagcacggtcgcttcctggaaattggcaaattcgacctttctcagaaccacccactt
ggcatggccatcttcctgaagaacgtgacattccacgggatcctactggatgcgcttttg
gagggcagtgctgaatggcaggaggtggcggcgctcctgcaggccggcatccgggagggg
gtggtacagcccctcaagtgcacagtgttccctggggcccaggtggaggacgccttccgc
tacatggcccaggggaagcacatcggcaaagtcctcgtgcaggtgcttgcggaggagccg
gaggcagtgctgaagggggccaaacccacgctgatgtcggccatttccaagaccttctgc
ccggcctacaagagctacatcatcgctggaggtctgggtggcctcggcctggagttggcg
cagtggctgatccagcgtggggcacagaagcttgtgttgacctctcgctccggggtccgg
acaggctaccaggccaagcaggtccgccagtggaggcgccagggcgtgcaggtgctggtg
tccaccagcaatatcagttctctggagggggcccggggcctcatcgccgaggcggcgcag
ctcgggcctgttggcggcatcttcaacctaaccatggtcttgagagacgccatgctggag
aaccagaccccggagttcttccaggacgtctgcaagcccaagtacagtggcaccctgaac
ctggacagggtgacccgggaggcgtgccctgagctggactactttgtggtcttctcctct
gtgagctccgggcgcggcaacgccggacagagcaactatggctttgccaactctgccatg
gagcgcatctgcgagaaacgccgacacgaaggcctcccaggcttggccgtgcagtggggc
gccatcggcgatgtgggcattttggcggacacagtgaacatcaacgccacagtcatcggt
ggcacgctgccccagcgtgtggcctcctgcctggaggtgctggacctcttcctgaaccag
ccccacatggtcctgagcagtttcgtgctggctgagaaggctgcggcctacagggacagg
gacggcgagcaggacctggtgaaggccgtggcacacatcctgggcatccgcgacttggct
gccgtcaacctggacagctcactggcggacctgggcctggactcgctaatgagcgtggag
gtgcgccagacgctcgagcacaagctcaacctggtgctctccatgcgcgaggtgcggcag
ctaacgctccggaaactgcaggagctgtccttgaaggcggatgcggccaatgagctggca
tcccccacgcccaaggaggacggtctgacccggcagcagactcaactgaacctgcgctcc
ctgctggtgaaccccgagggccccaccctgatgcagctcaattcagtgcagagctctgag
cgacccctattcctggtgcacccaatcgagggctccaccactgtgttccacagcctggcc
tcccggctcagcatccccacctatggcctgcagtgcacccgagctgcacccctcgacagc
atccacagcctggctgcctactacatcgactgcatcaggcaggtgcagcccgagggcccc
taccgcgtggctggctactcctatggggcctgcgtggcctttgaaatgtgctcccagctg
caggcccagcagagcccagcccctacccacaacagccttttcctgttcgatggttcgcac
acttacgtactggcctacacccagagctaccgggcaaagctgaccccaggctgtgaggct
gaggccgagacggaggccatatgcttcttcgtgcagcagttcacggacatggagcacaac
aaggtgctggaggcgctgctgccactgaagggcctggaggagcgcgtggcagccgccgtg
gacctgatcatcaagagccaccagggcctggaccgccaggagctgagcttcgcggccctg
tccttctactacaagctgcgcgccgctgagcagtacacgcccaaggccaagtaccatggc
aacgtgatgctgctgcgcgccaagacgggtggtgcctacggcgaggacctgggcgcagac
tacaacctctcccaggtatgcgacgggaaagtgtctgtccacgtcatcgagggtgaccac
cgcacgctgctggagggcagcggtctggagtccatcgtcagcatcatccacagctccctg
gctgagccacgtgtgagcgtgcgggaaggctag

DBGET integrated database retrieval system