KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655092Help
Entry
104655092         CDS       T03989                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00052  Galactose metabolism
rro00500  Starch and sucrose metabolism
rro01100  Metabolic pathways
rro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104655092
   00500 Starch and sucrose metabolism
    104655092
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104655092
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104655092
    3.2.1.20  alpha-glucosidase
     104655092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104655092
NCBI-ProteinID: XP_010352775
LinkDB All DBs
Position
Un
AA seq 933 aa AA seqDB search
MNFLVISAFLQVAIITDINLLLGEAYTVEWSIKIRDDEKIDCYPDENGASAENCAARGCI
WEASNSSGVPFCYFVNDLYSVNNVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTY
HKNEMLQFKIYDPNNNRYEVPVPLNVPRVPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTI
IWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWGMFSRDQPPGYKK
NSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGLLDFYVFLGPTPEL
VTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIANLYDEMVAAQIPYDVQYSDIDYME
RQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGLEDDIFIKYP
NDGDIVWGKVWPDFPGVVVNESLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNN
PQNPERSLKFDGLWIDMNEPASFVNGAVSPGCRDASLNHPPYMPHLESRNWGLSSKTLCM
ESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVISRSTFPSSGRWAGHWL
GDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNH
NTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSD
QLTWDIDSQFLLGPAFLVSPVLELNARDVTAYFPRARWYDYYTGVDINARGEWKTLPAPL
DHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAEGWLFWDDGQSIDTYGKG
LYYLANFSASQNTMQSHIIFNNYITDTNPLKLGYIEIWGVGSVPITSVSISVSGMAITPS
FNNYPTTQVLSIDVTDRNISVHNFTSLTWRSTP
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccttgtgatttctgcattcctacaggttgccattatcacagacatcaatctt
ctcctgggagaagcatacacagtggagtggagcataaagataagggatgatgaaaaaata
gactgttaccctgatgagaatggcgcttctgcagaaaactgcgctgcccgtggctgtatc
tgggaggcatccaattcttctggagtccctttttgctattttgtcaacgatctatactct
gtcaataatgttcaatataattcacatggggccacagctgacatctccttaaagtcttcc
gtttatgccaatgccttcccctccacacccgtgaacccccttcgcctggatgtcacttac
cataagaatgaaatgctgcagttcaagatttatgatcccaacaacaatcggtatgaagtt
ccagttcctctgaacgtacccagggtgccatccagcacccctgagggtcaactctatgat
gtcctcattaagaagaatccatttgggattgaaattcgccgcaagagtacaggcactata
atttgggactctcagctccttggcttcaccttcaatgacatgtttatccgcatctccacc
cgccttccctccaagtacctctatggctttggggaaactgagcacacatcctatagaaga
gacttggagtggcacacttgggggatgttctcccgagaccagcccccagggtacaagaag
aattcctatggtgtccacccctactacatggggctggaggaggacggcagtgcccacgga
gtgttcctgctgaacagcaatgccatggacgtgacgttccagcccctgcctgccttgaca
taccgtaccacagggggacttctggacttttatgtgttcttggggccaactccagagctt
gtcacccagcagtacactgagttgattggccggcctgtgatggtaccttactggtctttg
ggtttccagctgtgtcgctatggataccagaacgactctgagatcgccaacttgtatgac
gagatggtggccgcccagatcccttatgacgtgcagtattcagacattgactacatggag
cggcagctggatttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgc
atgaaagctgatgggatgcgggtcatcctcattctggatccagccatttctggcaatgag
acacagccctatcctgccttcacgcggggcttggaggatgacatcttcatcaaataccca
aatgatggagacattgtctggggaaaggtctggcccgattttcctggtgttgttgtgaat
gaatctctagactgggacagccaagtggagctatatcgagcttacgtggccttcccagac
tttttccgtaattcaactgccaagtggtggaagagggaaatagaagaactgtacaacaat
ccacagaatccagagaggagcttgaagtttgatggcctgtggattgatatgaatgaacca
gcaagcttcgtgaatggggcagtttctccaggctgcagggacgcctctctgaaccaccct
ccctacatgccacatttggagtccaggaactggggcctgagcagcaagaccctgtgcatg
gagagtcagcagatcctcccagacggctccccggtgcagcactacaacgtgcacaacctg
tacgggtggtcccagaccagacccacatacgaagccatgcaggaggtgacaggacagcga
ggggtcgtcatcagccgctccacatttccgtcttctggccgctgggcaggacattggctg
ggagacaacacggccgcgtgggatcagctgaagaaatctatcattggcatgatggagttc
agcctcttcggcatatcctatacaggagcagatatctgtgggttctttcaagatgctgaa
tatgagatgtgtgttcgctggatgcagctgggggccttttaccccttctcaagaaaccac
aacaccattgggaccaggagacaagaccctgtgtcctgggatgctgcttttgtgaacatt
tccagaaatgtcttgcagaccagatacaccctgttgccatatctgtataccttgatgcat
aaggcccacacagagggtgtcactgttgtgcggcctctgcttcatgagtttgtgtcagac
cagctgacgtgggacatagacagtcagttcctgctgggcccagccttcctggtcagccct
gtcctggagctcaatgccagagatgtcactgcatatttccctagagcccgctggtacgat
tactacacgggtgtggatattaatgcaagaggagagtggaagaccttgccagcccctctt
gaccacattaatcttcatgtccgtgggggctacatcctgccctggcaagagcctgcactg
aacacccacttaagccgccagaagttcatgggcttcaaaattgccttggatgatgaggga
actgctgagggctggctcttctgggatgatgggcaaagcattgatacctatgggaaagga
ctctattacttggccaacttttctgccagccagaatacgatgcaaagccatataattttc
aacaattacatcactgatacaaatcctttgaaactgggctacattgaaatctggggagtg
ggcagtgtccccattaccagtgtcagcatatctgtgagcggcatggccataacaccatcc
ttcaacaattaccccacgacacaggtattaagcatcgatgtgactgacagaaacatcagt
gtacataattttacttcattgacatggagaagcactccgtga

DBGET integrated database retrieval system