KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655094Help
Entry
104655094         CDS       T03989                                 

Definition
(RefSeq) probable maltase-glucoamylase-like protein
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00052  Galactose metabolism
rro00500  Starch and sucrose metabolism
rro01100  Metabolic pathways
rro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104655094
   00500 Starch and sucrose metabolism
    104655094
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104655094
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104655094
    3.2.1.20  alpha-glucosidase
     104655094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104655094
NCBI-ProteinID: XP_010352776
LinkDB All DBs
Position
Un
AA seq 2516 aa AA seqDB search
MARKLSVLEVLLIIFCLTVVVIDILLLLLVLEELSDTSFTPECPDIPHSERINCIPDQEV
TEDICRWQYKCCWSPVEDASVPRCFFPRNWGYEASNGHTSTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENIRLVDGTADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTKGMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQQYLELVGRPFLPPYWSLGFQLSRRDYGGINELKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHENGQKYVIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPAVFPDYTNPVCTEWWIDQVAKFHGHLEFDGVWIEMN
EVSSLLQASNDQCESNDLNFPPFLPRVLDHLLFARTLCMDTEFYGGLHYDIHSLYGHSMA
RTTNLALETVFMNNRSFILSRSTFAGSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYTNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGADSLLLSSSRH
YLNIRYTLLPYLYTLFYRAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYVFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
TDTDNLMFTEITILGMDKQPANFTILLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEF
SIRWNLPVSDPEKFNCYPDDPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYAASDIQ
YLSTSITANLSLLMASESAAAAAASDSVSAQISLLRLNVIYHTATMLQVKIYDPTNKRYE
VPVPLNTPPQPVGDPENCLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFTFNDMFLSIS
TRLPSQYIYGFGETEHTTFRRNMNWNTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAH
GVLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWA
LGFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIE
QMKKNGMRFILTLDPAISGNETQYLPFIRGQENNVFIKWPDTSDIVWGKVWPDLPDVTVD
GSLDHATQVKLYKAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEP
SNFVNGSVRGCSDEMLNNPPYMPYLESRDRGLNSKTLCMESQQILPDGSPVKHYNVHSLY
GWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGHWGGHWLGDNTAAWDQLGKSIIGMMEFS
LFGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLS
RKVLKTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILISPV
LETSTFEISAYFPRARWYDYSTGTSSKSTGQRKILKAPLDHINLHVRGGYILPWQEPAMN
THSSRQNFMGLTVALDDNGKAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHN
KYLSDSNPLKVGYIRIWGVNSTYVTQVNFTYDNWQFMETNFMSDPYNQTLTIQLTDKSIN
LEKLTEVTWIDGDPVLPTPTKTSTIPMSSPPSPSTTNATSSETITSSASANTTTGTTATI
PITTTSFPTSTIVTTSTSVPDTTAPFPTSNTTASTNAAVPITTTPFPTSTIGVTTNATVT
DTTAPFPTNITTASTNATVPTTTTPFPTSTIDVTTNAAVPDTSAPFPTSTTTASTNAAVP
ITTTPFATSTIGVTTNATVPDTTVPFPTNITTASTNATVPITTTPFATSTIGVTTSTTVP
DTTAPFLTSTTGASTRASVPFTTTPFPTNTADANTNNTVPNTTMPSPTGSTTVSTIATIP
ISVTPSLTSTADATISTTVLIATTPSLTITTDVSTSTTINDISTPFQTNTTNASTSTNVA
NITATSHTRTDDTVPNNTVPITAIPSLANTGVDTTSNSFSIMTTSFSESSNAIDTAVIMV
TTSPTSADVASTNNDASVTNSLLAKMSAGNTTSNSISITTTSFGNSVPIVTTPSPSPDAT
TTSSNTIPGMTTYYQTSPTTPTHTLTSIPSSITPILSMFPTSHTFTTDKITNFTTPTNAN
TIIFNTLDTKSTMIIDAMVTITSTRDNTISPDTTVTSTDKFTTHITQFTTPHSTTTTTLA
LSHTSLAPTNLSNIGTMDITDADNSSSVSGNTTHISVSNITTASDTITATGLDSQTPHMV
TNSVASYLPITATSATKDTTSITKYTLNTATPDSTVHTSATSPTYITNAINATQVP
NT seq 7551 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaagctcagtgtattggaagtccttctgatcatcttctgcctaactgtggtg
gtcatagatatcctcttgctgcttcttgtgttggaggaactttcagatacttcatttact
ccagagtgcccagatattccccactcggaaaggataaactgcatacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcacctgtggaggatgccagt
gtccctaggtgcttcttcccccgtaactggggctatgaagccagcaatggccatacaagt
acaagcacaggattcaccgcccagttgaaaaggttgccatccccatctctgtttggaaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaggctggttgat
gggactgctgatgcctccaatttgagctattacgtggaagttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacgagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagaacatgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggatgccacccccaccaagggcatgattaatctgtatggagctcatacattc
ttcttgtgccttgaagacaccagtggctcctcttttggagtttttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcaatcacttatcgcacgattggaggcatt
cttgacttttatgtattcctaggaaacactccagaacaagtggttcagcaatacttggag
cttgttggacggccattcttgcctccctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaatgaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgacgtccaatactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggaattacatgaaaatggacag
aaatatgttattattatgaatcctggcatctccaaaaactctaactacgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggttttgctgttggggaggga
tatccaggaccggcagtctttcccgattacaccaatccagtatgcactgagtggtggata
gatcaggttgctaaatttcatggtcatctggagtttgatggagtgtggattgaaatgaat
gaagtttctagcttactccaagcttctaatgaccagtgtgaatccaacgacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagttttatggaggccttcactatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccgtcttcatgaataacaggagcttcatcttatcc
cgttcaacttttgctggatctggccaatttgctgctcattggctgggggacaatgcggcc
acatgggatgacctccgatggtctattcccactattcttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttacaccaacaatgtcacggaggagctctgcaga
aggtggatgcaacttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcctgctgcctttggtgctgattccctgctgctgagttcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccgtgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccaca
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgccggtcttatat
gaaggtgtggacgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggctatcccatggaggaagcagttggtgaatatgcttctcccaggtgataagata
ggacttcatctgcgagggggctacgtatttcccactcaaaagccgaacacaaccacagaa
gccagccggaggaattccctgggactcatcattgccttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtaactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
acggacactgacaacctcatgtttacagaaatcacaatcttgggaatggacaaacagcca
gctaattttactatcttactgaataatgtcgccacctccagtccaagcgttgtctacaat
gcttccacaaaggttgtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacccggagaagttcaactgctaccctgacgat
ccaacagcctctgaggagagttgtcggcagcgggggtgtctttgggaggatacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgctgctagtgacattcag
tacctgagcactagcattactgcaaacctttccctcctgatggcctctgagtcagctgct
gctgctgctgcctctgattctgtctctgcacagatcagcctcctccgcctcaatgtgatc
tatcacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaaggtacgag
gttccagtaccactgaacactcctcctcaaccagttggtgaccctgaaaactgtctgtat
gatgtcaggattcagaacaatccttttggaatccagatccaacgcaaaaactccagcact
gtgatttgggattctcaactccctggcttcaccttcaatgacatgtttctctccatttct
acgcgtctgccctctcagtacatctatggttttggggaaactgagcacacgactttcaga
cgaaacatgaactggaacacatggggaatgtttgctcgcgatgagccacctgcgtacaag
aagaattcctatggtgtccacccttactacatggcactggaggaggatggtagtgcccat
ggagtgctcctgctaaatagcaatgccatggatgtgacgttacagcccactcctgccctg
acataccgcaccactggagggattttggacttctacattgttttggggccaacccctgaa
cttgtaactcagcaatacaccgagttgatcggtcggccagcaatgattccatactgggcc
ttgggattccagctaagtcgctatggataccagaatgatgctgaaatctccagtttgtat
gatgcaatggtggcagcccagattccctatgatgtccagcatgtagacatcgattacatg
aaccggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctgattgag
caaatgaagaaaaatggcatgagatttattctcactttggacccagccatttctggcaat
gagacacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcct
gacaccagtgacattgtctggggaaaggtttggccagatctgcctgatgtaactgtagat
ggatcccttgaccatgcaactcaggttaagctttacaaggcctacgttgcctttcctgac
ttctttcgtaatagcacagctgcatggtggaagaaagagatagaagagctctatgcaaat
cctcgagagccagagaagagcctgaagtttgatggattgtggattgatatgaatgagcca
tcaaactttgtgaatggatctgtcaggggctgcagcgatgaaatgctaaataacccaccc
tatatgccatatttggaatctagggacaggggcctgaacagcaagaccctgtgcatggag
agtcagcagatcctgccagacggctcccccgtgaagcattacaacgtgcacagcctgtac
gggtggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggg
atcgtcatcacccgctccacatttccctcttctggacactggggaggacactggctggga
gacaatacagctgcgtgggaccagctggggaaatctatcattggcatgatggagttcagt
ctctttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatat
gagatgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaac
aacattgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtcc
agaaaagtcctaaagaccagatacaccctgcttccttatctctatactctgatgcataaa
gctcatgttgagggcagcactgttgttcgaccccttctccatgagtttacggatgacagg
acaacatgggatatagaccgtcagttcatgttgggtcctgctatcttaatcagccctgtg
ttggaaactagcacatttgagatctctgcttattttccgagagcccgttggtatgactat
agcacgggaactagcagcaaatcgacaggtcagaggaaaatcctgaaggctccccttgac
cacatcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgcaatgaac
actcactccagtcgacagaattttatgggattgactgttgctttggatgacaatgggaaa
gctgaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaat
tattttttggcaaactttatagcagctcagaacatcctgcaaatccagaccatacacaat
aagtatttgagtgactcgaatccactgaaagttggatatattagaatctggggtgtgaac
tctacttatgtgacacaagtcaatttcacctatgacaactggcaatttatggagacaaat
ttcatgagtgacccttataatcagacactaactattcaattgactgacaagagtatcaac
ctggaaaagttaactgaggttacttggattgatggtgatcctgtacttcccactccaact
aagacaagcaccatcccaatgagttctcctccttctccatctactaccaatgccaccagt
tctgagacaatcaccagttctgccagtgcaaatactaccactggcactactgctactatt
cccatcacaaccacatctttcccaacaagtactattgttacaactagtacttctgttcct
gatacaactgcgcctttccctacaagtaatactacagctagcactaatgctgctgttcct
attacaaccacaccttttccaacaagtactattggtgttactactaatgctactgttacc
gatactactgcccctttcccgacaaatattactactgcaagcactaatgctactgttcct
accacaaccacacctttcccaacaagtactattgatgttacaactaatgctgctgttcct
gatacatctgctcctttccctacaagtactactactgctagcactaatgctgctgttcct
atcacaaccacaccttttgcaacaagtactattggtgttacaactaatgctactgttccc
gatacaactgtccctttcccgacaaatattactactgcaagcactaatgctactgttcct
atcacaaccacaccttttgcaacaagtactattggtgttacaactagtactactgttcct
gatacaactgctcctttccttacaagtactactggtgctagcactagggctagtgttcct
tttacaaccacacctttccctacaaatactgctgatgctaacactaataatactgttcct
aataccactatgccttctcctacaggtagtactactgtgagtactattgctaccattccc
atttcagtgactccttctctgacaagtactgctgatgccaccattagtactactgtactt
attgccactactccttctctaacaattactactgatgttagcactagtactactattaat
gatataagtactccttttcaaacaaatactactaatgctagcactagtactaatgttgct
aatataactgctacctctcatacaaggactgatgatactgttcctaataatactgttcca
attacagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttct
attatgaccacttctttctctgaaagtagtaatgctatagatactgctgttattatggta
accacttctcctacaagtgctgatgttgctagcacaaataatgatgcttctgtgacaaat
tctcttttagctaaaatgtctgctggtaatacaactagtaatagtatttccataacaact
acttcttttggtaatagtgttcctattgtgactactccttctccaagtcctgatgctact
actacaagtagtaatactattcctggcatgactacttattaccaaacttctcctaccact
cctacccatactcttacttctattcctagctctattactcctattttgagcatgtttcca
acaagtcatacattcactactgataaaattactaattttactacccctacaaatgcaaac
accataattttcaacactcttgatacaaaaagtaccatgataatagatgctatggtcact
attaccagcaccagagataataccataagtccggatacaacagttacttccacagacaaa
ttcaccacacacatcacacagttcactactccccattctactactactacaacactggcc
ttaagccacacatcattagctcctacaaatctttctaatataggcaccatggatattact
gatgcagataactccagcagtgtttcaggtaacactacacacatttctgtttcaaatatc
acaacagcttcagacacaataacagctactggtctagattcacaaactccccacatggta
acaaattctgtggctagttatttacctattactgcaactagtgctaccaaagatactaca
agtattacaaaatatactttaaatactgccactcctgatagtacagtacatacctctgct
acttcacctacttatattaccaatgccataaatgctactcaagttccatga

DBGET integrated database retrieval system