KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655097Help
Entry
104655097         CDS       T03989                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04972  Pancreatic secretion
rro04974  Protein digestion and absorption
rro05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104655097
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    104655097
   04974 Protein digestion and absorption
    104655097
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104655097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rro01002]
    104655097
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104655097
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104655097
Peptidases [BR:rro01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104655097
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104655097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 OstA_2
Motif
Other DBs
NCBI-GeneID: 104655097
NCBI-ProteinID: XP_010352780
UniProt: A0A2K6RUV6
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MKTFIFLALLGAAATFPTSDDDDKIVGGYTCQRNSVPYQVSLNAGYHFCGGSLIDKKWVV
SAAHCYKSQIQVRLGEYNIKVYEGNEQFINATKIIRHPKYNSATIDNDIMLIKLSSAATI
HSQVATVSLPTSCAVAGTQCLISGWGNTLSSGTNYPDLLQCLKAPILSNTPCRTAYLGKI
TTNMICLGFLEGGKDSCQGDSGGPVVCNNELQGIVSWGNGCAQKSKPGVYTKVCNYVKWI
QQTIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatcttccttgctctcctgggagctgctgccactttccccactagtgat
gatgatgacaagatagttgggggctacacctgtcagaggaattctgttccctatcaggtg
tccctgaatgctggctatcacttctgtggcggctccctcatcgataaaaaatgggtggtg
tccgcagctcactgctacaagtcccaaatccaagtgcgtctgggagaatacaacattaag
gtctatgaaggcaatgaacaattcataaatgcaaccaagattattcgccaccccaagtat
aactcagccaccattgataatgacatcatgctgattaagctgagctcggccgccaccatc
cactctcaagtggccaccgtctctctaccaacatcctgtgcagtggctggtactcagtgc
ctcatctctggctggggcaacacgctgagcagtggcaccaactaccctgacctcctgcag
tgtctgaaggctcccattctctctaacactccttgccgcacagcctacctgggcaagatt
actacaaacatgatatgtctgggattcctggagggtggaaaggactcttgccagggtgac
tctggtggccctgtggtctgcaacaacgaactccagggcattgtctcctggggcaatggt
tgcgctcagaagagcaaacctggagtctacactaaagtttgcaactatgtgaaatggatt
cagcagaccattgctgccaactaa

DBGET integrated database retrieval system