KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655169Help
Entry
104655169         CDS       T03989                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00730  Thiamine metabolism
rro00790  Folate biosynthesis
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    104655169 (ALPI)
   00790 Folate biosynthesis
    104655169 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104655169 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104655169 (ALPI)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     104655169 (ALPI)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104655169 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Enzymes
  104655169 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 104655169
NCBI-ProteinID: XP_010352867
UniProt: A0A2K6NZB7
LinkDB All DBs
Position
Un
AA seq 528 aa AA seqDB search
MQGPWVLLLLGLRLQLSLATIPVEEENPAFWNRQAAEALGAAKKLQPIQKVAKNLILFLG
DGMGVPTVTAARILKGQKNGKLGPETPLAMDHFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKANYQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQDGCQDIATQLISNMDIDVILGGGRKYMFPRGTPDPEYPSDA
SQNGIRLDGKNLVQEWLAKHQGTRYVWNYTELMQASLDQSVTHLMGLFEPGDTKYEINRD
PTLDPSLLEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGLAYHALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKARDSKAYTSILYGNGPGYVL
NAGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MALAACLEPYTACDLAPPAGTTDAAHPVPASLPLLAGTLLLLGAAAAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctggccacc
atcccagttgaggaggagaacccagccttctggaaccgccaggcagccgaggccctgggt
gccgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggt
gatgggatgggggtgcccacggtgacagccgctaggatcctaaaggggcagaagaatggc
aaactggggcctgagacacctctggccatggaccacttcccatacgtggctctgtccaag
acgtacaatgtggacagacaggtgccagacagcgcaggcacagccacagcctacctgtgt
ggggtcaaggccaactaccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgtggcaatgaggtcatctccgtgatgaaccgggccaagaaagcaggaaag
tcagtgggagtggtaaccaccacacgggtgcagcatgcctcgccagccggcacctacgca
cacacggtgaaccgcaactggtactcagatgctgacatgcctgcctcggcccgccaggat
ggctgccaggacattgccacacagctcatctccaacatggacattgacgtgatcctgggt
ggaggccgcaagtacatgtttcccagggggaccccagaccctgagtacccaagtgatgcc
agccagaatggaatcagactggatgggaagaacctggtgcaggaatggctggcaaagcac
cagggtacccggtacgtgtggaactacactgagctcatgcaggcatccctggaccagtct
gtgacccatctcatgggcctctttgaacccggagacacgaaatatgagatcaaccgagac
cccacactggacccctccctgctggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttctacctcttcgtggagggtggtcgcatcgaccatggtcatcatgag
ggcttggcttaccatgctctcaccgaggcagtcatgttcgatgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgaccctcgtcactgctgaccactcccacgta
ttctcatttggtggctacaccttgcgagggagctccatcttcgggttggcccccagcaag
gctcgggacagcaaagcctacacgtccatcctgtacggcaatggcccaggctacgtgctc
aacgcaggcgtgcgaccagacgtgaatgagagtgagagcgggagccccgattaccagcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgttcgcg
cgcggtcctcaggcgcacctggtgcacggtgtgcaggagcagagcttcgtagcgcacgtc
atggccttggccgcctgcctggagccctacacggcctgcgacctggcgccccccgccggc
accaccgacgctgcgcacccagttcccgcgtcgctgcctctgctggccgggaccctgctg
ctgctgggggcggccgctgctccctga

DBGET integrated database retrieval system