KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655196
Entry
104655196         CDS       T03989                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04064  NF-kappa B signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04510  Focal adhesion
rro04621  NOD-like receptor signaling pathway
rro05145  Toxoplasmosis
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104655196 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104655196 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104655196 (XIAP)
   04215 Apoptosis - multiple species
    104655196 (XIAP)
   04217 Necroptosis
    104655196 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655196 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104655196 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655196 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104655196 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104655196 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104655196 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104655196 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104655196 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104655196 (XIAP)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104655196 (XIAP)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104655196 (XIAP)
Peptidases and inhibitors [BR:rro01002]
 Peptidase inhibitors
  Family I32: IAP family
   104655196 (XIAP)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104655196 (XIAP)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    104655196 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 104655196
NCBI-ProteinID: XP_010352897
UniProt: A0A2K6Q6A4
LinkDB
Position
7
AA seq 497 aa
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFADFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENSATQSTNSGIQNGQYKVENY
LGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIITFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKE
STQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggaa
gaagaatttgtagaagagtttaatagattaaaaacttttgcagattttccaagtagtagt
cctgtttcagcatcaacactggcacgagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagctgtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
agtgccacacagtctacaaattctggtatccagaatggtcagtacaaagtcgaaaactat
ctgggaagcagaaatcattttgccttagacaggccatctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccaaggaaccctgccatg
tatagtgaagaagctagattaaagtcctttcagaactggccagactatgctcacctaacc
ccaagagagttagcaagtgctggactctactacacaggtattggtgaccaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatcttaatattcgaagtgaa
tctgatgctgtgagttctgataggaatttcccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatcattacttttgggacatggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggagcaacat
gctaaatggtatccagggtgtaaatatctgttagaacagaagggacaagaatatataaac
aatattcatttaacccattcacttgaggagtgtctggtaagaactactgagaaaacacca
tcactaactagaagaattgatgataccatcttccaaaatcctatggtacaagaagctata
cgaatggggttcagtttcaaggacattaagaaaataatggaggaaaaaattcagatatct
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagag
agtacgcaagatgagtcaagtcagacttcattacagaaagagattagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctatt
gtttttgttccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaag
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663843
Entry
104663843         CDS       T03989                                 

Gene name
BIRC7
Definition
(RefSeq) baculoviral IAP repeat-containing protein 7 isoform X1
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04120  Ubiquitin mediated proteolysis
rro04215  Apoptosis - multiple species
rro05145  Toxoplasmosis
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104663843 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    104663843 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663843 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104663843 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104663843 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104663843 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104663843 (BIRC7)
Peptidases and inhibitors [BR:rro01002]
 Peptidase inhibitors
  Family I32: IAP family
   104663843 (BIRC7)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104663843 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 zf-C3HC4_2 DUF2039 zf-RING_2 zf-RING_UBOX TerY_C ArfGap
Other DBs
NCBI-GeneID: 104663843
NCBI-ProteinID: XP_010363520
UniProt: A0A2K6QST0
LinkDB
Position
13
AA seq 298 aa
MGPEDSAKCLRHGPQLSRWVAGDRPAQERCGPRSLGSPALGLDTCRAWDHVDGQILGQLR
PLAEEEEEEGAGATSPRGPAFPGMGSEELRLASFYDWPLTAGVPPELLAAAGFFHTGQQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPAPGDPELPTPRREVQSESAQEPGGASPAQAQSGWWVLEPPGARDAE
EQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPSLQLCPICRAPIRSRVRTFLS
NT seq 897 nt   +upstreamnt  +downstreamnt
atggggcctgaagacagtgccaagtgcctgcgccatggaccacagctgagccgctgggta
gccggtgaccgtcccgcgcaggagcgctgtggaccccgctctctgggcagccctgcccta
ggcctggacacttgcagagcctgggaccatgtggatgggcagatcctgggccagctgcgg
cccctggcagaggaggaagaggaggagggcgccggggccacgtcgcccagggggcctgcc
ttccctggcatgggctctgaagagctgcgtctggcctccttctatgactggccgctgacg
gctggggtgccgcccgagctgctggccgctgctggctttttccacacaggccagcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcattcccagctgctgggctcctgggacccgtgg
gaagaaccggaagatgcagcccctgtggccccctccgtccctgcccctggggaccctgag
ctgcccacgccgagaagagaggtccagtctgaaagtgcccaggagccaggaggagccagt
ccagcccaggcccagagcgggtggtgggttcttgagcccccaggagccagggatgcggag
gagcagctgcgacggctgcaggaggagaggacttgcaaggtgtgcctggaccgtgccgtg
tccatcgtctttgtgccatgcggccacctggtctgtgctgagtgtgcccccagcctgcag
ctgtgccccatctgcagagcccccatccgcagccgtgtgcgcaccttcctgtcctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674657
Entry
104674657         CDS       T03989                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04064  NF-kappa B signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04621  NOD-like receptor signaling pathway
rro04668  TNF signaling pathway
rro05132  Salmonella infection
rro05145  Toxoplasmosis
rro05168  Herpes simplex virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104674657 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104674657 (BIRC3)
   04064 NF-kappa B signaling pathway
    104674657 (BIRC3)
   04668 TNF signaling pathway
    104674657 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104674657 (BIRC3)
   04215 Apoptosis - multiple species
    104674657 (BIRC3)
   04217 Necroptosis
    104674657 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674657 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104674657 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674657 (BIRC3)
   05202 Transcriptional misregulation in cancer
    104674657 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104674657 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104674657 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104674657 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104674657 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104674657 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104674657 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104674657 (BIRC3)
Peptidases and inhibitors [BR:rro01002]
 Peptidase inhibitors
  Family I32: IAP family
   104674657 (BIRC3)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104674657 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX OTT_1508_deam
Other DBs
NCBI-GeneID: 104674657
NCBI-ProteinID: XP_010377353
UniProt: A0A2K6QS02
LinkDB
Position
15
AA seq 604 aa
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPVEKHKKLYPSCRFVQSLNSVNNSEATSQPTFPSSVTSS
THSLLPGTENSGYFSGSYSSFPSNPVNSRANQDFSALMRSSYHCAMNNEKARLLTFQTWP
LTFLSPTDLAKAGFYYVGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNTEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFICQVQASYPHLLEQLLSTSDSPEDENAESS
IIHFEPGEDHSEDAIMMNTPVVNAAVEMGFSRSLVKHTVQRKILATGDNYRLVSDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTARIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEADAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaatagcatattcttatcaaatttgatgaaaagtgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtctcagaaaggagtcttgctcgcgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgcggcctgatgctagataactggaaaagaggagac
agtcctgttgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tcagttaacaactcagaagctacctctcagcctacttttccttcttcagtaacaagttcc
acacattcattacttccgggtacagaaaacagtggatatttcagtggctcttattcaagc
tttccatcaaatcctgtaaactccagagcaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataatgaaaaagccagattacttacttttcagacgtggcca
ttgacttttctgtcgccaacagatctggcaaaagcaggcttttactacgttggacctgga
gacagagtggcttgctttgcctgtggtggaaaactgagcaattgggaaccgaaggataat
gcaatgtcagaacacctgagacattttcccaaatgcccatttatcgaaaatcagcttcaa
gacacttcgagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatactgagcagcttgcaagtgcaggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggtggaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatctgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatctacatcagacagcccagaagatgaaaatgcagagtcatca
attattcattttgaacctggagaagaccattcagaagacgcaatcatgatgaatactcct
gtggttaatgctgccgtggaaatgggctttagtagaagcctggtaaaacacacagttcag
agaaaaatcctagcaactggagacaattatagactcgtcagtgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccagaattattaatgaacaagaacatgat
gttattaaacagaagacacagacatctttacaagcaagagaactgattgatactatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgatgctgtg
ttatatgagcatttatttgtacaacaggacataaagtatattcccacagaagatgtttca
gatctaccagtggaagaacagttgcggagattacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgtaaagat
tgtgctccttctttaagaaagtgtcctatttgcaggagtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674658
Entry
104674658         CDS       T03989                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04064  NF-kappa B signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04621  NOD-like receptor signaling pathway
rro04668  TNF signaling pathway
rro05132  Salmonella infection
rro05145  Toxoplasmosis
rro05168  Herpes simplex virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104674658 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104674658 (BIRC2)
   04064 NF-kappa B signaling pathway
    104674658 (BIRC2)
   04668 TNF signaling pathway
    104674658 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104674658 (BIRC2)
   04215 Apoptosis - multiple species
    104674658 (BIRC2)
   04217 Necroptosis
    104674658 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674658 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104674658 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674658 (BIRC2)
   05202 Transcriptional misregulation in cancer
    104674658 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104674658 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104674658 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104674658 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104674658 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104674658 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104674658 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104674658 (BIRC2)
Peptidases and inhibitors [BR:rro01002]
 Peptidase inhibitors
  Family I32: IAP family
   104674658 (BIRC2)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104674658 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 104674658
NCBI-ProteinID: XP_010377354
UniProt: A0A2K6QTZ2
LinkDB
Position
15
AA seq 618 aa
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIEKHKQLYPSCSFIQNLVSAT
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDFSPSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGDENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFSRDLVKQTVQSKILTT
GENYRTVNDIVSALLNAEDEKREEEKERQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTVLVKGNAAANIFKNCVKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctcgtatcaaaacattaagagt
ataatggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggtt
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctatt
gaaaagcataaacaactatatcctagctgtagctttattcagaatctggtttcagctact
ctgggatccacctctaagaatacttctccaatgagaaacagttttgcacattcattatct
cccaccttggaacatagtagcttgttcagtggttcttactccagcctttcaccaaaccct
cttaattctagagcagttgaagacttctctccatcgaggactaacccctacagttatgca
atgagtactgaagaagcccgatttcttacctaccatatgtggccattaacttttttgtca
ccgtcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacac
cggagacactttcccaactgtccatttttggaaaattctctggaaacgctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtattggcca
tccagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaa
ggtcaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
tcaacttcggatactactggagatgaaaatgctgacccaccaattattcattttggaccc
ggagaaagttcttcagaagatgccgtcatgatgaatacacctgtggttaaatctgccttg
gaaatgggctttagtagagacctggtaaaacaaacagttcaaagtaaaatcctgacaact
ggagagaactacagaacagttaatgatattgtatcagcacttcttaatgctgaagatgaa
aaaagagaagaggagaaggaaagacaagctgaagaaatggcatcagatgatttgtcatta
attcggaagaatagaatggctctctttcaacagttgacgtgtgtgcttcctattttggat
aatcttttgaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcgagagaactgattgataccgttttggttaaaggaaatgctgca
gccaacatcttcaaaaactgtgtaaaagaaattgactctacattgtataagaacttattt
gtggataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaa
caattgaggaggttacaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
attgtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

DBGET integrated database retrieval system