KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655298
Entry
104655298         CDS       T03989                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2 isoform X1
  KO
K05637  laminin, alpha 1/2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104655298 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104655298 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655298 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655298 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104655298 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104655298 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104655298 (LAMA2)
   05414 Dilated cardiomyopathy
    104655298 (LAMA2)
   05416 Viral myocarditis
    104655298 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104655298 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104655298 (LAMA2)
   05145 Toxoplasmosis
    104655298 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 LXG DUF948 HSBP1
Other DBs
NCBI-GeneID: 104655298
NCBI-ProteinID: XP_030784658
LinkDB
Position
4
AA seq 3224 aa
MPGAAGVLLLLLLSGGLRGGQAQLPQQQRRPQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRSLSLNIHGKYIGGGVCINCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCNPTG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCNCKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLSGRIRVAPQQDDSDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTEHVLQFMIILEGNDLRISTAQDEVYLHPSEEHINVLVLKEESF
TIHGTHFPVSRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSVAAA
VEVCQCPPGYTGSSCEKRHQANASSNLIPANNTKSCWPRHRRVNGTIFGGICEPCQCFGH
AESCDDVTGECLNCKDHTGGPYCDKCLPGFYGDPTKGTSEDCQPCACPLNIPSNNFSPTC
HLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSL
SGSCLICKPGTTGRYCELCADGYFGDAVDARNCQPCHCNANGSFSEICHRQTGQCECRAN
VQGQRCDKCKPNMWWDPEKRFCVLCDCDPVGSVSPQCDITGRCVCKTDFVGKQCNLGRQV
HQQEEQPQRAQRVLGSPQRWAIGSSSGCPRGAYRAPAPPGTFGLQSARGCVPCNCNSFGS
KSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLGNNCDPKTGRCICPP
NTIGEKCSKCAPNTWGHSITTGCKTCNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECS
RGHWNYPRCNLCDCFLPGTDAATCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCQPGKFG
LDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIAFQH
PEIVAHMDLMREDLRWEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYNPQV
IIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVHRTVTREDFLDILY
DIHYILIKATYGNFMRQSRISEISMEVAEQGRRTAVTPPAHLIEKCDCPLGYSGLSCEAC
LPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALG
YYGIVKGLPNDCQQCACPLISSSNNFSPSCVTEGLDDYRCTACPRGYEGQYCERCAPGYT
GSPSSPGGSCQECECDPYGSLPVPCDPVTGICTCRPGATGRKCDGCKHWHAREGWECVFC
GDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMIQELKHLLSPQQAPERLIQ
LAEGDLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNE
KAIKLNETLGTRDEAFERNLERLQKEIDQMIKELRRRNLETQKEIAEDELVAAEGLLKKV
KKLFGESRGKNEEMEKDLREKLADYKNKVDDAWDLLREATNKIREANRLFAVNQKNMTAL
EKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNNKI
DDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDY
IDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGSLQKSFRILNEAKKLANDVKENEDH
LNGLKTRIENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQ
IKQLHQNLDGLKKNYDKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLK
PIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNV
KTAVADNLLFYLGSAKFIDFLAIEMRRGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIMA
SRTGRNGTISVRALDGPKASIVPSTYHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAV
RVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRP
IRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVGN
QNHNDGKWKSFTLSRIQKHANISIVDIDTNQEENIATSSSGNNFGLDLKADDKIYFGGLP
TLRNLRPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVE
LSPVPVDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQAYYAILLNRGRLEVH
LSTGARTMRKIVVRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPLEVK
KLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSVPMDFARPVSFKNADIGRCVHQKLRED
EDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSKQFGLSRNSHIAIAF
DDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSYDLGSGDTNTMI
PTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPRKADILDVVGMLYVGGLPINYTTRR
IGPVTYSIDGCIRNLHMEEAPADLEEPTSSFHVGTCFANAQRGTYFDGTGFAKAVGGFKV
GLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAGVPG
HLCDGQWHKVTANKIKHRIELTVDGNQVEAQSLNPASTSADTNDPVFVGGFPDDLKQFGL
TTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
NT seq 9675 nt   +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctcctcctgctgctctccgggggcctcaggggcggt
caggcgcagctgccgcagcagcagcggcggccacaggcacatcagcaaagaggtttattc
cctgctgtcctgaatcttgcttctaatgctcttatcacaaccaatgcaacatgtggagaa
aagggacctgaaatgtactgcaaattggtggaacatgtccctgggcagcctgtgaggaac
ccccagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccgattaca
aatgctattgatggaaagaacacttggtggcagagtcccagtattaagaatggaatcgaa
taccattacgtgacaattacactggatttacagcaggtgttccagattgcatatgtgatt
gtgaaggcagctaactcccctcggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagatacggagtgcctaaccctttac
aatatttatccccgcactgggccaccgtcatatgccaaagacgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
ggaagaccaagtgccgatgatccttctccagaactgctggagtttacctctgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatattactactcggtcaaggat
atttcagttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcaacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctaactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaagtctgagtttgaatatacatggaaagtacattggagggggtgtttgcattaat
tgtacccaaaatactgctggtataaactgtgagacatgtattgatggcttcttcagaccc
aaaggggtatcgccaaattatccaaggccatgccagccatgtcattgcaatccaactggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcaaaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccagactgcaaagcctgtaactgcagtggcttagggagcaaaaatgaggac
ccttgttttggcccctgtaactgcaaggagaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaaggctgcgatgagtgtttctgt
tcaggtgtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgacctttctggccgcattcgagtggctccccagcaggacgac
tcggactcacctcaacagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcaccagctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgacctggaagaagaggaagaagatacagaacatgtt
ctccagtttatgattatcttagagggtaatgacttgagaatcagcacagcccaagatgag
gtgtacctgcacccatctgaagaacatattaatgtattagtacttaaagaagaatcattt
accatacatggcacacattttccagtcagtagaaaggaatttatgacagtacttgcgaat
ttgaagagagtcctcctacaaatcacatacagctttgggatggatgccatcttcaggttg
agctctgttaaccttgaatctgctgtctcctatcctactgatggaagcgttgcagcagct
gtagaagtatgtcagtgcccaccagggtatactggctcctcttgtgaaaagcgacaccaa
gctaatgcttcctctaatctcatacctgccaataacactaagtcttgttggcctaggcac
aggcgagttaacggcaccatttttggtggcatctgtgagccatgtcagtgctttggtcat
gcagagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacacaggcggc
ccatattgtgataaatgtcttcctggtttctatggcgatcctactaaaggaacctctgaa
gactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagcccaacgtgc
catttagaccggagtcttggattgatctgtgatggatgccctgtcgggtacacaggacca
cgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggaggatcatgt
cagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgacagcttg
tctggctcctgtctgatatgtaaaccaggtacaacaggccggtactgtgagctctgtgct
gatggatattttggagacgcagttgatgcaaggaactgtcagccctgtcactgtaatgcc
aatggctctttctctgagatttgccaccgtcaaactggacagtgtgagtgcagagccaac
gtgcagggccagaggtgtgacaaatgcaagcccaatatgtggtgggatccagagaagcga
ttctgtgtgctatgtgactgcgatcccgttggctctgtgtcaccgcaatgtgatattaca
ggaagatgtgtctgtaaaacagacttcgtagggaaacagtgcaacctcggcaggcaggtg
caccaacaggaggagcagccgcagagagcgcaacgggtgctgggttctcctcagaggtgg
gctatcggcagctccagcgggtgccctcggggagcctatcgggccccagctccgcctggg
acctttggtctgcaatcagcaaggggctgtgttccctgcaactgcaattcttttgggtct
aagtcattcgactgtgaagagagtggacaatgttggtgccaacccggagtcacagggaag
aaatgtgaccgctgtgcccatggctatttcaacttccaagaaggaggctgcacagcttgt
gaatgttctcatctgggtaataattgtgacccaaagactgggcgatgcatttgccctccc
aataccattggagagaaatgttctaaatgtgcacccaatacctggggccacagcattacc
actggttgtaagacttgtaactgcagcacagtgggatccttggatttccaatgcaatgta
aatacaggccaatgcaactgtcatccaaaattctctggtgcaaaatgtacagagtgcagt
cgaggtcactggaactaccctcgctgcaatctctgtgactgcttcctccctgggacggat
gccgcaacctgtgattcagagactaaaaaatgctcctgtagtgatcaaactgggcagtgc
acttgtaaggtgaatgtggaaggcatccactgtgacagatgccagcctggcaaattcgga
ctcgatgccaagaatccacttggctgcagcagctgctattgcttcggcactactactcag
tgctctgaagcaaaaggactgatccggacgtgggtaactctgaaggctgagcagaccatt
ctacccctggtagatgaggctctgcagcacacaaccaccaagggcattgcttttcaacat
ccagagattgttgcccacatggacctgatgagagaagatctccgttgggaacctttttat
tggaaacttcctgaacaatttgaaggaaagaagttgatggcctatgggggcaaactcaag
tatgcaatctatttcgaggctcgggaagaaacaggtttttctacatataatcctcaagtg
atcattcgaggtgggacacctactcatgctagaattatcgtcaggcatatggctgctcct
ttgattggccaattgacaaggcatgaaattgaaatgacagagaaagaatggaaatattat
ggggacgatcctcgagtccatagaactgtgacccgagaagacttcttggatatactgtat
gatattcattacattcttatcaaggctacttatggaaatttcatgcgacaaagcaggatt
tctgaaatctcaatggaggtagctgaacaaggacgtagaacagcagtgactcctccagct
cacttgattgaaaaatgtgattgccccctgggctattctggcctgtcctgtgaggcatgc
ttgccaggattttatcgactgcgttctcaaccaggtggccgcacccctggaccaaccttg
ggcacctgtgttccatgtcaatgtaatggacacagcagcctgtgtgaccctgaaacatcg
atatgccagaattgtcaacatcacactgctggtgacttctgtgaacgatgtgctcttgga
tactatggaattgtcaagggattgccaaatgactgtcagcaatgtgcctgccctctgatt
tcttccagtaacaatttcagcccctcttgtgtcacagaaggccttgatgactaccgctgc
acggcttgtccacggggatacgaaggccagtactgtgaaaggtgtgcccctggctatact
ggcagtccaagcagccctggaggctcctgccaagaatgtgagtgtgatccctatggctca
ctgcctgtgccctgtgaccctgtcacaggaatctgcacgtgccgacccggagccacggga
aggaagtgtgacggctgcaagcactggcatgcacgcgagggctgggagtgtgttttttgt
ggagatgagtgcactggccttcttctcggggacttggctcgcctggagcagatggtcatg
agcatcaacctcactggtccgctgcctgcgccatataaaatgctgtatggtcttgaaaat
atgattcaggagctaaagcacctgctctcacctcagcaggccccagagaggcttattcag
ctggcagagggcgatctgaatacactcgtgaccgaaatgaacgagctgctgaccagggct
accaaagtgacagcagatggcgagcagaccggacaggatgctgagaggaccaacacaaga
gcaaagtccctgggagaattcattaaggagcttgcccgggatgcagaagctgtaaatgaa
aaagctataaaactaaatgaaactctaggaactcgagacgaggcctttgagagaaatttg
gaaaggcttcagaaagagattgaccagatgattaaagaactgaggaggagaaatctagag
acacaaaaggaaattgctgaagacgagttggtagctgcagaaggccttctgaaaaaggtg
aaaaagctgtttggagagtcccggggaaaaaatgaagaaatggagaaggatctccgagaa
aaactggcagactacaaaaacaaagttgatgatgcttgggacctgttgagagaagccacg
aataaaatcagagaagctaatcgcttatttgcagtaaaccagaaaaacatgactgcgttg
gagaaaaagaaggaggctgttgaaagtgggaaacgacaaattgagaacactttaaaagag
ggcaatgacatactcgatgaagccaaccgtcttgcagatgaaatcaactccatcatagat
tatgttgaagacatccaaactaaattgccacctatgtctgaggagcttaacaacaaaata
gatgacctctcccaagaaataaaggacaggaagcttgccgagaaggtgtcccaggctgag
agccacgcagctcagttgaatgactcatctgctgtccttgatggaatccttgatgaggct
aaaaacatctccttcaatgccactgcagccttcaaagcttacagcaatattaaggactat
attgatgaagctgagaaagttgccaaagaagccaaagatcttgcacatgaagctacgaaa
ctggcaacaggtcctcggggtttgttaaaggaagatgccaaaggctctcttcagaaaagc
ttcaggattcttaacgaagccaagaagttagcaaatgatgtaaaagaaaatgaagaccat
ctaaatggcttaaaaaccaggatagaaaatgctgatgctagaaatggggatctcttgaga
gctttgaatgacactttgggaaagttatcagctattccaaatgacacagctgctaaactg
caagctgttaaggacaaagccagacaagccaacgacacagctaaagatgtactggcacag
attaaacagctccatcagaacctcgatggcctgaagaagaattacgataaactagcagac
agcgtcgccaaaacgaatgctgtggttaaagatccctccaagaacaaaatcattgccgac
gcagatgccactgtcaaaaatctagaacaggaagctgaccggctaatagataaactcaaa
cccatcaaggaacttgaggataatctaaagaaaaacatctctgagataaaggaattgata
aaccaagctcggaaacaagccaattctatcaaagtatctgtgtcttcgggaggtgactgc
attcgaacatacaagccagaaatcaagaaaggaagttacaataatattgttgtcaatgta
aagacagctgttgctgacaacctcctcttttatcttggaagtgccaaatttattgacttt
ctggctatagaaatgcgtagaggcaaagtcagcttcctctgggatgttggatctggagtt
ggacgtgtagagtacccagatttgactattgatgactcatattggtaccgtatcatggca
tcaagaactgggagaaatggaactatttctgtgagagccctggatggacccaaagccagc
attgtacccagcacataccattcgacgtctcctccagggtacactattctagatgtggat
gcaaatgcaatgctgtttgttggtggcctgactgggaaattaaagaaggctgatgctgta
cgtgtgattacattcaccggctgcatgggagaaacatactttgacaacaaacctataggt
ttgtggaatttccgagaaaaagaaggtgactgcaaaggatgcactgtgagtcctcaggtg
gaagatagtgaggggactattcagtttgatggagaaggttatgcattggtcagccgcccc
attcgctggtaccccaacatctccactgtcatgttcaagttcagaacattttcttcgagt
gctctcctgatgtatcttgccacacgagacctgagagatttcatgagtgtggagctcact
gatgggcacataaaagtcagttatgatctgggttcgggaatggcttccgttgtcggcaat
caaaaccataatgatgggaaatggaaatcattcaccctgtcaagaattcaaaagcacgcc
aacatatcgattgtagatatagatactaatcaggaggagaacatagcaacttcatcttct
ggaaacaactttggtcttgacttgaaagcagatgacaaaatatattttggtggcctgcca
acgctgagaaacttgaggccagaagtaaatctgaagaaatattccggctgcctcaaagat
attgaaatttcaagaacgccgtacaatatcctcagtagtcccgattatgttggtgttacc
aaaggatgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggag
ctctcccctgtgccagttgatgtaggaacagaaatcaacctgtccttcagcaccaagaat
gagtctggcatcattcttttgggaagtggagggacaccagcaccacctaggagaaaacga
aggcagactggacaggcctattatgcaatactcctcaacaggggccgtctggaagtacat
ctctccacaggggcacgaacaatgcggaaaattgtcgtcagaccagagccgaatctgttt
catgatggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaa
gtcgatgaaaacagaagatatatgcaaaacctgacagttgaacagcctcttgaagttaaa
aagcttttcgttgggggtgctccgcctgaatttcaaccttccccactcagaaatattcct
ccttttgaaggctgtgtgtggaatcttgttattaactctgtccccatggactttgcaagg
cctgtatccttcaaaaacgctgacattggtcgctgtgtccatcagaaactccgtgaagat
gaagatggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcc
tttcctacacccaccccagttctgacacatggtccttgtgctgcagaatcagaaccagct
cttttgatagggagcaagcagtttggcctttcaagaaacagtcacattgcaattgcattt
gatgacaccaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaa
tccggcttgcttttttacatggctcgcatcaatcatgctgattttgccacagttcagctg
agaaatggattgccctacttcagctatgacttggggagtggggacaccaacaccatgatc
cccaccaaaatcaatgatggccagtggcacaagattaagataatgagaagtaagcaagaa
ggaattctttatgtagatggggcctccaacagaaccattagtcccagaaaagctgacatc
ctggatgttgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaaga
attggtccagtgacctatagcattgacggctgcatcaggaatctccacatggaagaggcc
cctgctgatctggaagagcccacctccagcttccatgttgggacatgttttgcaaatgct
cagaggggaacatattttgatggaacaggttttgccaaagcagttggtggattcaaagtg
ggattggaccttctcgtagaatttgaattccgcacaactagaacgactggagttcttcta
gggatcagtagtcaaaaaatggatggaatgggtattgaaatgattgatgaaaagctgatg
tttcatgtggacaatggcgccggcagattcactgctatctatgatgctggggttccaggg
catttgtgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgag
ctcacagtcgatgggaaccaggtggaagcccaaagcctaaacccagcatctacatcagct
gacacaaatgaccctgtatttgttggaggcttcccagatgacctcaagcagtttggcctg
accaccagcattccgttccgaggttgcatcagatccctgaagctcaccaaaggcacgggc
aagccactggaagttaattttgccaaggccctggaactgaggggtgttcaacctgtatca
tgcccagccaactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658850
Entry
104658850         CDS       T03989                                 

Gene name
COL4A6
Definition
(RefSeq) collagen alpha-6(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04974  Protein digestion and absorption
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104658850 (COL4A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104658850 (COL4A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104658850 (COL4A6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104658850 (COL4A6)
  09154 Digestive system
   04974 Protein digestion and absorption
    104658850 (COL4A6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658850 (COL4A6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104658850 (COL4A6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104658850 (COL4A6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104658850 (COL4A6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104658850 (COL4A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104658850 (COL4A6)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104658850 (COL4A6)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104658850 (COL4A6)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104658850 (COL4A6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 104658850
NCBI-ProteinID: XP_010357271
UniProt: A0A2K6RKZ6
LinkDB
Position
7
AA seq 1705 aa
MHPGLWLLLVTLCLTEELAGAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPS
GPQGFTGSTGLSGLKGERGSPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPP
GLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPSSFKGMKGDPGLPGLDG
ITGPQGAPGSPGAVGPAGPPGLQGPPGPPGPPGPDGNMGLGFQGEKGVKGDVGLPGPAGP
PPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGSTGEKGEKGIPGLPGPRGP
MGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGEKGDIGLPGPDVFIDIDGAVISGNPGDP
GVPGLPGLKGDEGIQGLRGPSGVPGSPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAG
LPGRDGLPGPPGPPGPPSPEFETKTLHNKEPGFPGLRGEQGPKGNPGLKGIKGDSGFCAC
DGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGSPGPSGPKGK
KGEPILSTVSGMPGDRGDSGSQGFPGIIGKPGNDGVPGLPGLPGLPGDGGQGFPGEKGLP
GLPGEKGHPGPPGLPGIGLPGLPGPRGLPGDKGKDGLPGQQGPPGSKGDCCCREKVGKGD
LDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGYRGLPGTPGQPGSSGNKGKPGSPGLVH
LPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGL
QGLTGDKGLLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGK
SGPPGAPGFPGTSGHPGKKGTRGEKGPPGSIVKKGLPGLKGLPGNPGLIGLKGSPGSPGV
TGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGHAGTPGEKGD
RGNLGPVGIPSPRRPMSNLWLKGDKGSQGSAGSDGFPGPRGDKGEAGHPGPPGLPGASGL
PGTIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGTSGLPG
LKGDNGQTLEISGSPGPKGQPGESGFKGTKGRDGPIGNIGFPGNKGEDGKVGVSGDVGLR
GALGFPGIAGMRGDPGLPGSSGHQGAIGPLGPPGLIGPKGFPGFPGLHGLNGLPGTKGTH
GTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAP
GISLPSLIAGQPGDPGRPGLDGERGRPGPPGPPGPTGPSSSQGNTGDPGFPGIPGPKGPK
GDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGPQGAP
GQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGP
PGALGDPGLRGLQGPPGFEGAPGQQGPFGMPGMPGQSARVGYTLVKHSQSEQVPLCPIGM
SQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLS
TTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMH
TAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGEL
PVSETLKAGQLHTRVSRCQVCMKSL
NT seq 5118 nt   +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctcctggttacgttgtgcctgaccgaggaactggcagga
gcgggagagaagtcttatggaaagccgtgtgggggccaagactgcagtgggagctgtcag
tgttttcctgagaaaggagcgagagggcgacctggaccaattggaattcaaggcccatca
ggtcctcaaggattcactggctctactggtttatcgggattgaaaggagaaaggggttcc
ccaggccttctgggaccttatggaccaaaaggagataagggtcccatgggagttcctgga
tttcttggcatcaatgggattccgggccatcctggacagccaggccccagaggcccacct
ggtctggatggctgtaatggaactcaaggagctgtcggatttccaggccctgatggctat
cctgggcttctcggaccacctgggcttcctggtcagaaaggatcaaaaggtgaccctgtc
cttgctccaagtagtttcaaaggaatgaagggggatcctgggctgcctggactggatgga
atcactggcccacaaggagcacccggatctcctggagctgtaggacctgcaggaccacca
ggattacaaggtcctccagggcctcctggtcctcctggtcctgatgggaatatggggcta
ggttttcaaggagagaaaggagtcaagggggatgttggcctccctggcccagcaggacct
ccaccatctactggagagctggaattcatgggattccccaaagggaagaaaggatccaag
ggtgaaccagggcctaagggttttccaggcataagtggccctccaggcttcccgggcctt
ggatctactggagaaaagggagaaaagggaatccctggtttgccaggacctaggggtccc
atgggttcagaaggagtccaaggccctccagggcaacagggcaagaaagggaccctggga
tttcctgggcttaatggattccaaggaattgagggtgaaaagggtgacattggcctgcca
ggcccagatgttttcatcgatatagatggtgctgtgatctcaggtaatcctggagaccct
ggtgtacctggcctcccaggccttaaaggagatgaaggcatccagggcctgcgtggccca
tctggtgtccctggctcaccagcattatcaggtgtcccaggagccctagggcctcaggga
tttccagggctgaagggggaccaaggaaacccaggccgtaccacaattggagcagctggc
ctccctggcagagatggtttgccaggcccaccaggtccaccaggcccacctagtccagaa
tttgagaccaaaactctacacaacaaagagccagggttccctggtctccgaggagaacag
ggtccaaaaggaaacccaggcctcaaaggaataaaaggagactcaggtttctgtgcttgt
gacggtggtgttcccaacactggaccacccggggaaccaggcccacctggtccacggggt
ctcataggccttccaggccttaaaggagccagaggagatcgaggctctgggggtgcacag
ggcccagcaggggctccaggcttagttgggtctccgggtccttcaggacccaaaggaaag
aagggggaaccaattctcagtacagtctcaggaatgccaggggatcgcggtgattctggc
tcccagggcttccctggtataataggaaaaccaggcaacgacggagtaccaggtctacca
ggtctgccaggacttccgggtgatggtgggcagggcttcccaggtgaaaaggggttacct
ggacttcctggtgaaaaaggccatcctggtccacctggcctcccgggaattgggttacca
ggacttcctggaccccgtgggcttcctggagataaaggcaaggatggattaccgggacaa
caaggccctcctggatctaagggtgactgctgctgcagagagaaggttggtaaaggagac
ttagacacagagagaggaatcaccctgccctgtattattccggggtcatatggtccatca
ggatttccaggcactcccggattcccaggccctaaagggtaccgaggcctccctgggacc
ccaggccagcctggatcaagtggaaataaaggaaagccagggagtccaggattggttcat
cttcctgaattaccaggatttcctggacctcgtggggagaagggcttgcctgggtttcct
gggctccctggaaaagatggcttgcctgggatgattggtagtccaggtttacctggttcc
aagggagccactggtgatatctttggtgctgaaaatggtgctccgggggaacaaggccta
caaggattaacaggggacaaaggacttcttggagactctggccttccaggactcaagggt
gtgcacgggaaacctggcttgctaggccccaaaggtgagcggggcagccctggaacacca
ggacaggtgggacagccaggcaccccaggatctagtggtccgtatggcatcaagggcaaa
tctggtcccccaggagcgccaggcttcccaggcacctcagggcatcctggaaagaaagga
acaagaggcgagaaaggccctcctggatcaattgtaaagaaagggctgccagggctaaaa
ggccttcctggaaatccaggcctaatagggctgaaaggaagcccaggctctccaggggtc
actgggttgccagccctctctggacccaaaggagaaaaggggtctgttggattcgtaggt
tttccaggaataccaggtctgcctggtatccctggaacaagaggattaaagggaattcca
ggatcaactggaaaaatgggaccatctggacacgctggcactcctggtgaaaagggagac
agaggcaatctggggccagtcggaatacctagtccaagacgtccaatgtcaaacctttgg
ctcaaaggagacaaaggctctcaaggctcagccggatctgatggatttccagggccaaga
ggtgacaaaggagaggctggtcatcctgggccaccaggcctgcctggagcttctggcctc
ccaggcactatcaaaggagttagtggaaagccaggtccccctggcttcatgggaatccgg
ggcttacctggcctgaaggggtcctctgggataacaggtttcccaggaatgccaggagaa
agtggttcacaaggtatcagagggtcgcctggactcccaggaacatctggtctcccaggc
ctgaaaggagacaacggccagacacttgaaatttccggtagcccaggacccaagggacaa
cctggtgaatctggttttaaaggcacaaaaggaagagatggaccaataggcaatataggc
ttccctggaaacaaaggtgaagatggaaaagttggtgtttctggagatgttggccttcgt
ggagctctagggtttccagggattgccggcatgagaggagatccaggacttccaggctct
tctggtcatcaaggggcaattgggcccctaggaccccccggattaataggacccaaaggc
ttccctggatttcctggtttacatggactgaatgggcttccgggaaccaagggtacccat
ggcactccaggacctagtatcactggtgtgcccgggcctgctggtctccctggacccaaa
ggagaaaaaggatatccaggaattggcatcggagctccagggaagccgggcctgagaggg
caaaaaggtgatcgaggtttcccaggtctccagggccccgctggtctccccggtgcccca
ggcatctccttgccctcactcatagcaggacagcctggtgaccccgggcgaccaggccta
gatggagaacgaggccgcccaggcccccctggacccccaggtcccactgggccatcctcg
agtcaaggcaacaccggagaccctggcttccctggaattcctggacctaaagggcctaag
ggagaccaaggaattccaggtttttctggccttcctggagagctaggactgaaaggcatg
agaggtgagcctggcttcatggggactccaggcaaggttgggccacctggagacccagga
tttcccgggatgaaggggaaggcagggccaagaggctcttctggcccccaaggtgctcct
ggacaaacaccaactgcagaagctgtccaggttcctcctggacccttgggtctaccaggg
atcgatggcatccctggcctcactggggaccctggggctcaaggccctgtaggcctacaa
ggctccaaaggtttacctggcattcccggcaaagatggtcccagtgggctcccaggccca
cctggggctcttggtgatcctggtctgcgtggactgcaaggccctccaggatttgaagga
gctccagggcagcaaggccccttcgggatgcctggaatgcctggccagagcgcgagagtg
ggctacacgttggtaaagcacagccagtcggaacaggtgcccctgtgtcccatcgggatg
agccagctatgggtggggtacagcttactgttcgtggaggggcaagagaaagcccataac
caggacctgggctttgctggctcctgtctgccccgcttcagcaccatgcccttcatctac
tgcaacatcaacgaggtgtgccactatgccaggcgcaatgataaatcctactggctctcc
actactgcccctatccccatgatgcccgtcagccagacccagattccccagtacatcagc
cgctgctctgtgtgtgaggcaccctcgcaagccattgctgtgcacagtcaggacatcacc
atcccgcagtgccccctgggctggcgcagcctctggattgggtactccttcctcatgcac
actgccgctggtgccgagggtggaggccagtccctggtctcacctggctcctgcctagag
gactttcgggccacccctttcatcgagtgcagtggtgcccgaggcacctgccactacttt
gcaaacaaatacagtttctggttgaccacagtggaggagaggcagcagtttggggagttg
cctgtgtctgaaacgctgaaagctgggcagctccacactcgagtcagtcgctgccaggtg
tgtatgaaaagcctgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659760
Entry
104659760         CDS       T03989                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha-4 isoform X1
  KO
K06241  laminin, alpha 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05143  African trypanosomiasis
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104659760 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104659760 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104659760 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659760 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104659760 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104659760 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104659760 (LAMA4)
   05145 Toxoplasmosis
    104659760 (LAMA4)
   05143 African trypanosomiasis
    104659760 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_EGF Laminin_G_3
Other DBs
NCBI-GeneID: 104659760
NCBI-ProteinID: XP_010358184
UniProt: A0A2K6N8J2
LinkDB
Position
4
AA seq 1823 aa
MALSSAWRWVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFRTLSGECVPCDCNGNSNECLDGSGFCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGLEPPTGTDCSTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTIKHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRRRQPFFTQRELVDEEADEAHELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNHVRDAEDMNRATAARQRDHEKQQERVREQMEVVNTSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKNELQVKLSNLSNLSHDLVQEAIDHAQELQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIINYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATTPMANNLTNWSQNLQHFDSSAYNTAVDS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHPRTSMDDLKAFTSLSLYVKPPVKQPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYIYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPHSLNLPGFIGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITKRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSSGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAAPEILQSRTLRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVVMDVKGIKVQSVDKQYNDGLSHFVITSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQAGEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKRKNLSKPKASQNKKGGKSKDAPSWD
PVALKFPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
NT seq 5472 nt   +upstreamnt  +downstreamnt
atggctttgagctcagcctggcgctgggtcctgcctctgtggctcctctggagcgctgcc
tgctcccgcgccgcgtccggggacgacaacgcttttccttttgacattgaagggagctca
gcggttggcaggcaagacccgcctgagacgagcgagccccgcgtggctctgggacgcctt
ccgcctgcggccgagaaatgcaatgctggattttttcgcaccctgtcgggggaatgtgtg
ccctgcgactgtaatggcaattccaacgagtgtttggacggctcaggattctgtgtgcac
tgccagcggaacacaacaggagagcactgtgaaaaatgtctggatggttatatcggagat
tccatcaggggagcaccccgattctgccagccgtgcccctgtcccctaccccacttggcc
aattttgcagaatcttgctataggaaaaatggagctgttcggtgcatttgtaaagaaaat
tatgctggacctaactgtgaaagatgtgctcctggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcagatcccaacctgatctttgaa
gattgtgatgaagtcactggccagtgtaggaactgcttacgcaacaccaccggattcaag
tgtgaacgctgtgctcctggctactatggggacgccaggatagccaagaactgtgcagtg
tgcaactgtgggggaggcccatgtgacagtgtaaccggagaatgcttggaagaaggtttg
gaaccccctacaggcacggactgctcaaccataagctgtgataagtgtgtctgggacctg
actgatgacctgcggttagcagcactctccattgaggaaggcaaatccggggtgctgagc
gtatcctctggggccgccgctcataggcacgtgaatgaaatcaacgccaccatctacctc
ctcaaaacaaaattgtcagaaagagaaaaccaatacgccctaagaaagatacaaatcaac
aatgctgagaacacgatgaaaagccttctgtctgacgtagaggaattagttgaaaaggaa
aatcaagcctccagaaaagggcaacttgttcagaaggaaagcatggacaccattaaacac
gcaagtcagcttgtagagcaagcccatgatatgagggataaaatccaagagatcaacaac
aagatgctctattatggggaagagcatgaacttagccccaaggaaatctctgagaagctg
gtgttggcccagaagatgcttgaggagattagacgccgtcaaccattttttacccaacgg
gagcttgtggatgaggaggcagatgaggctcacgaactgctgagccaggctgagagctgg
cagcggctgcacaatgagacccgcactctgtttcctgtcgtcctggagcagctggacgac
tacaatgctaagttgtcagatctccaggaagcacttgaccaggcccttaaccacgtcagg
gatgctgaagacatgaacagggccacagcagccaggcagcgggaccacgagaaacaacag
gaaagagtgagggaacaaatggaagtggtgaacacgtctctgagcacatctgcggactct
ctgacaacacctcgcctaactctttcagaacttgatgatataataaagaatgcatcaggg
atttatgcagaaatagatggagccaaaaatgaactacaagtaaaactatctaacctaagt
aacctcagccatgatttagtccaagaagctattgaccatgcacaggaacttcaacaagaa
gctaatgaactgagcaggaagttacacagttcagatatgaacgggctggtacagaaggct
ttggatgcatcaaatgtctatgaaaatatcattaattatgttagtgaagccaatgaaaca
gcagaatttgctttgaacaccactgaccgaatttatgatgcggtgagtgggattgatact
caaatcatttaccataaagatgaaagtgagaacctcctcaatcaagccagagaactgcaa
gcaaaagcagagtctagcagtgatgaggcagtggctgacactagcaggcgtgtgggtgga
gccctagcaaggaaaagtgcccttaaaaccagactcagtgatgccgttaagcaactacaa
gcagcagagagaggggatgcccagcagcgcctggggcagtccaggctgatcaccgaggaa
gccaacaggacgacgatggaggtgcagcaggccaccacccccatggccaacaatctaacc
aactggtcacagaatcttcaacattttgactcttctgcttacaacactgcagtggactct
gctagggatgcagtaagaaatctgacagaggttgtccctcagctcctggatcagcttcgt
acagttgagcagaagcggcctgcaagcaacgtttctgccagcatccagaggatccgagag
ctcattgctcagaccagaagtgttgccagcaagatccaagtctccatgatgtttgatggc
cagtcagctgtggaagtgcacccgagaaccagtatggatgacttaaaggcttttacgtct
ctgagcctgtacgtgaaaccccctgtgaagcagccagaactgaccgagactgcagatcag
tttatcctgtaccttggaagcaaaaatgccaaaaaagagtatatgggtcttgcaataaaa
aatgataacctggtatacatctataatttgggaaccaaagacgtggagattcccctggac
tccaagcccgtcagttcctggcctgcttacttcagcattgtcaagattgaaagggtggga
aaacatggaaaggtgtttttaacagtcccgagtctaagtagcacagcagaggaaaagttc
attaaaaagggggaattttcaggagatgactccctgctggacctggaccccgaggacacg
gtgttttatgttggtggagtgccttccaacttcaagctccctcacagcttaaacctgcct
ggcttcattggctgcctggaactggccactttgaataatgatgtgatcagcttgtacaac
tttaagcacatctataatatggacccctccacatcagtgccctgtgcccgagataagctg
gccttcactcagagccgggctgctagttacttcttcgatggctctggttatgccgtggtg
agagacatcacaaagagagggaaatttggtcaggtgactcgctttgacatagaagttcga
acaccagctgacaatggccttattctcctgatggtcaatggaagtatgtttttcagactg
gaaatgcgcaatggttacctacacgtgttctatgattttggattcagcagtggccctgtg
catcttgaagatacgttaaagaaagctcaaattaatgatgcaaaataccatgagatctca
atcatttaccacaatgataagaaaatgatcttggtagttgacagaaggcatgtcaagagc
atggataatgaaaagatgaaaataccttttacagatatatacattggaggagctgcccca
gaaatcttacaatccaggacccttagagcacaccttcccctagatatcaacttcagagga
tgcatgaagggcttccagttccaaaagaaagatttcaatttactggagcagacagaaacc
ctgggagttggttatggatgcccagaagactctcttatatctcgcagagcatatttcaat
ggacagagcttcattgcttcaattcagaaaatatctttctttgatggctttgaaggaggt
tttaatttccgaacattacaaccaaatgggttactattctattatgcttcagggtcagat
gtgttctccatctcactggataacggtactgtcgtcatggatgtaaagggaatcaaagtt
cagtcagtagataagcagtacaatgatgggctgtcccacttcgtcattacctctgtctca
cccacaagatatgaactgatagtagataaaagcagagttgggagtaagaatcctaccaaa
gggaaaatagaacagacacaagcaggtgaaaagaagttttacttcggtggctcaccaatc
agtgctcagtatgctaatttcactggctgcataagtaatgcctactttaccagggtggat
agagatgtggaggttgaagatttccaacggtatactgaaaaggtccacacttctctttat
gagtgtcccattgagtcttcaccattgtttctcctccataaaaaacgaaaaaatttatcc
aagcctaaagcaagtcagaataaaaagggagggaaaagtaaagatgcaccttcatgggat
cctgttgccctgaaattcccagagcggaatactccaagaaactctcattgccacctttcc
aacagccctagagcaatagagcacgcctatcaatatggaggaacagccaacagccgccaa
gagtttgaacacttaaaaggagattttggtgcaaaatctcagttttccattcgtctgaga
actcgttcctcccatggcatgatcttctatgtctcagaccaagaagagaatgactttatg
actctatttttggcccacggccgcttggtttacatgtttaatgttggtcacaagaaactg
aagattagaagccaggagaaatacaatgatggcctgtggcatgatgtgatatttattcga
gaaaggagcagtggccgactggtaattgatggtcttcgagtcttagaagaaagtcttcct
cctactgaagctacctggaaaatcaagggtcccatttatttgggaggtgtggctcctgga
aaggctgtgaaaaatgttcagattaactccatctacagttttagtggctgtctcagcaat
cttcagctcaatggggcctccatcacctctgcttctcagacattcagtgtgaccccttgc
tttgaaggccccatggaaacaggaacttacttttcaacagaaggaggatacgtggttcta
gatgaatctttcaatattggattgaagtttgaaattgcatttgaagtccgtcccagaagc
agttccggaaccctggtccacggccatagtgtcaatggggagtacctaaatgttcacatg
aaaaatggacaggtcatcgtgaaagtcaataatggcatcagagatttttccacctcagta
acacccaagcagagtctctgtgatggcagatggcacagaattacagttattagagattct
aatgtggttcagttggatgtggactctgaagtgaaccacgtggttggacccctgaatcca
aaaccaattgatcacagggagcctgtgtttgttggaggtgttccagaatctctactgaca
ccacgcttggcccccagcaaacccttcacaggctgcatacgccactttgtgattgacgga
cacccagtgagcttcagtaaagcagccctggtcagcggcgccgtgagcatcaactcctgt
ccagcagcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660568
Entry
104660568         CDS       T03989                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104660568 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104660568 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104660568 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660568 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104660568 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104660568 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104660568 (LAMC3)
   05145 Toxoplasmosis
    104660568 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 104660568
NCBI-ProteinID: XP_030774921
LinkDB
Position
16
AA seq 1575 aa
MAAAKLLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHNQDESTWWQSPSMAFGVQYPTSVNI
TLHLGKAYEITYVRLKFHTSRPESFAIYKRSRANGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDTAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPVGCSSC
FCYGHSKVCAATAQFQVHHILTDFHQGAEGWWARSVGGPEHPPQWSPHGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFQVPPRGSPLPVQLRLEGAGLALSLRHSSLSGPQDVGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLTNLTSLRLHVSPGPSPAGQVFLTEVRLTSAR
PGLSPPASWVETCSCPNGYMGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVACTHCPPG
QRGRRCEVCDDGFFGDPLGLSGLPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTAG
DHCERCREGFYGSALAPRPADKCKPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTGRDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCRECPSCYALV
KEEAAKLKAKLTLMEGWLQGSNCGSPWGPLDILQGEAPRGDVYQGHHLLPGVREAFLEQM
MGLEGAVKASREQLQRLSKGAHCAQAGAQKTCTQLADLEAVLESSEEEILHAAAILASLE
IPQDGPGQPTKWSHLATEARALARSHRDTATKIAATAQRALLASNTSYVLLWSLLEGRMA
LETQRDLEDRYQEVQAAQKALGTAMAELLPEAESVLATVQHVGADTAPYLALLASPGALP
QKSWAEDLGLKAKTLEKTVASQQHMATKASRTLQAAAQAALRQTEPLTQLHREARTALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVRDRLLADMRKKTKQA
ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLREGNQAHRRASRLTSQTQATLQQA
SRQVLDSEARQQELQEAEQVGAGLSEMEQQIRESRISLEKDIEALSELLARLGSLDTHQA
PAQALNETQWALERLRLQLASPGALQRKLRLLEQESELQELQIQGFESDLAEIRADKRNL
EAILHSLPENCASWQ
NT seq 4728 nt   +upstreamnt  +downstreamnt
atggcggcggctaagctcctgctggggttggcgctgctggcacctcgggcggccggcgcg
ggcatgggagcgtgctacgacggcgcggggcgcccgcagcgctgcctgcccgtgttcgag
aacgcggcgttcggccggcttgcccaggcctcgcacacgtgcggcagcccgccggaggac
ttctgcccccacgtgggcgccgcgggcgcgggggcgcagtgccagcgctgcgacgcagcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacaaccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccacctggggaaggcttacgagatcacgtatgtgaggctaaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccaacggcccgtgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cctggcgaggatgagcgcgtggccttctgcacctccgagttcagcgacatctccccgctg
agtgggggcaatgtggccttctccaccctggagggccggcccagcgcctacaacttcgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggaccccaaggtgctccagtcctactactat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgt
ggccccgacacggcgggccagttggcctgccggtgtcagcacaacaccaccggcacggac
tgtgagcgctgcttgcccttcttccaggaccgtccgtgggcccggggcaccgctgaggcc
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgttcgatcgg
gagctcttccgcagcacaggccacggcggccgctgtcaccactgccgtgaccacacagcc
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccattcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgatcgctgtctgcccgggttccac
tcgctcagcgagggaggctgcagaccctgcacctgcaatcctgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacttatgtgac
agatgtcgccctgggacttttaacctgcagccccacaatccggtcggctgcagcagctgt
ttctgctatggccactccaaggtgtgcgcagccactgcccagttccaagtgcatcacatc
ctcaccgatttccaccagggagccgaaggctggtgggccagaagtgtggggggccccgag
caccccccacaatggagcccacatggggtcctcctgagcccagaagacgaggaggagctc
acagcaccagagaagttcctgggagaccagcggttcagctatgggcagcccctcatcctg
accttccaggtgccccccaggggctccccactccctgtgcagctgaggctggaaggggcg
ggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgtcgggcatccc
agggaggtagagctcaggttccacctgcaggagacctctgaggatgtggcccctccgctg
cccccgttccacttccagcggctcctcaccaacctgaccagcctccgcctccatgtcagt
cccggtcccagccctgctggccaagtgttcctgactgaggtccggctcacatctgcccgg
ccagggctttccccgccagcttcctgggtggagacttgttcatgtcccaatggctacatg
ggccagttctgcgaatcctgtgctccgggatacaagagggagatgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgcgtctgcagccaccataccgagggcccatcctgtgaacgctgcttgccgggtttc
tatggcaaccccttcgcgggccaagccgatgactgccagccatgtccctgccctggccag
tcggcctgcacgaccatcccagagagcggggaggtggcgtgcacccactgccccccgggt
cagagagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctggggctc
tcggggctcccccagccctgccaccagtgccagtgcagcgggaatgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccgcgggt
gaccactgtgagcgctgtcgtgaaggtttctatgggagcgccctggcccctcggcccgca
gacaaatgcaagccctgcagctgccacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccagtgctcctgcctgcctcacgtgactggacgggattgtagccgc
tgctaccctggcttctttgacctccagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacagatgccagctgggtttcttcggcttctccatcaag
ggctgccgggcctgcaggtgctccccactgggcgctgcctcagcccagtgccacgagaac
ggcacatgcgtatgcaggcctggctttgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagatggcacacactgccgggaatgcccgtcctgctatgccctggtg
aaggaggaggcagccaaactgaaggccaaactgactttgatggaggggtggctgcaaggg
tccaactgtggcagtccctggggaccactagacattctgcagggagaggccccaaggggg
gacgtctaccagggccaccacctgcttccaggagttcgggaagccttcctggaacagatg
atgggcctcgaaggtgctgtgaaggcctcccgggagcagctgcagaggctgagcaagggt
gcccactgtgcccaggccggagcccagaagacctgcacccagctggcagacctggaggca
gtgctggagtcctcggaagaggagatcctgcatgcagctgccattctcgcgtctctggag
attcctcaggatggtcctggccagcccaccaaatggagccacctggccacagaggcccgt
gccctcgccaggagccacagagacaccgccaccaagattgcagccactgctcagagggcc
ctgctcgcctccaacaccagctacgtgcttctctggagtctgctggagggaaggatggcc
ctagagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccagaaagca
ctggggacagctatggcagagttgctgcctgaagcggaaagcgtcttggccacagtgcag
cacgttggcgcagatacagccccgtacctggctttgctggcttctccgggagctctgcct
cagaagtcctgggctgaagacctgggcctgaaggcgaagaccctggagaagacagttgca
tcacaacagcacatggccaccaaggcttcccgaaccctccaggctgctgcccaggcggca
ctacggcaaacagagcccctcacacagctacaccgggaggccagaaccgccctgacccag
gcttcctcatctgtccaggctgccacagtgactgtcatgggagccaggactctgctggct
gacctggaaggaatgaagctgcagtttcctcggcccaaggaccaggcggcactgcagagg
aaggcagactccgtcagggacagactccttgcagacatgagaaagaagaccaagcaggcg
gagaggatgctaggaaacgcggcccctctttcctccagtgccaagaagaagggcagagaa
gcagaggtgttggccaaggacagtgccaagcttgccaaggccttgctgagggaggggaac
caggcgcaccgccgtgccagccggctcaccagccagacgcaagccacgctccaacaggcg
tcccggcaggtgctggattctgaagcacgccaacaggagctgcaggaagctgagcaggtg
ggtgctgggctgagtgagatggagcagcagatccgggaatcacgcatctccctggagaag
gacatcgaggccttgtcagagctgcttgccaggctggggtcgctggacacccatcaagcc
ccagcccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcagctggcc
tccccgggggccttgcagaggaaactcaggctgctggagcaggaatctgagctgcaggag
ctgcagatccagggcttcgagagcgacctcgccgagatccgtgccgacaaacggaacctg
gaggccattctgcacagcctgcctgagaactgtgccagctggcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663822
Entry
104663822         CDS       T03989                                 

Gene name
LAMA5
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104663822 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104663822 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104663822 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663822 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104663822 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104663822 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104663822 (LAMA5)
   05145 Toxoplasmosis
    104663822 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_N Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 104663822
NCBI-ProteinID: XP_030769770
LinkDB
Position
13
AA seq 3694 aa
MAKRLCAGSALCVRGPPGPAPLLLVGLALLGTARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CHGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPDHPL
DSPHVCRRCNCESNFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCVCKPNFRGTHCELCVPGFYGPGCQP
CQCSSPGVADDRCDPDTGQCRCREGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCPCQHGFAGPHCDQCHPGYHGFPNCQPCTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPSFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLALADPALPEAQAPCVCRANVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDP
RGTLGGVAECQPGTGQCFCKPHVCGQACAACRDGFFGLDQADYFGCRSCRCDAGGALGQS
CEPRTGACRCRPNTQGPTCSRPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSAACANC
TAQSQPVVFPPSTEPAFVTVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSTQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLVTCTGSDVDVQLQVAVPQPGHYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
SLHPCLYSTLCRGAARDTQDRLAVFHLDSEASVRLTAEQARFYLHGVTLVPMEEFSPEFV
EPRVRCISSHGAFGPSSAACLPSRFPKPPQPIILRDCQVLPLPPGLPLTHAQDLMPATSP
TGPQPRPPTAVDPDVEPTLLHDPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPEGRWLWLDYVLVVP
ENVYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGC
HEVGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCIC
PPRTVPPDCLLCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDTDSGQCKCRPNVTGRR
CDTCSPGFHGYPHCRPCDCHEAGTAPGVCDPFTGQCYCKENVQGPRCDQCSLGTFSLDAA
NPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERRPGTEMLRADLRH
VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPTESRPDVVLQGN
QMSMTFLEPAHPLPGHTHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFS
QISSAVSLRRVALEVASPAGQGTLASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGR
CVPCQCHGHSDRCLPGSGICVDCQHNTEGAQCERCQAGFVSSREDPSAPCVSCPCPLSVP
SNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLL
FSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCAPCGTEACNPHSGQC
LCKAGVTGRRCDRCREGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR
ECAPGYWGFPEQGCRRCQCPGGRCDPHTGRCTCPPGLSGERCDTCSQQHQVPVPGGPGDH
SVHCEVCDHCVVLLLDDLERTGTLLPAIREQLRGINASSVAWARLHRLNTSITDLQSQLR
SPLGPRHETAQQLEVLEQQSTSLRQDAQQLGSQASGTRDQASRLLAGTEATLGRAKTLLA
AIRAVDRTLSELMSQTGHLGLANASALSGEQLRRTLAEVERLLWEMRARDLGAPRAAAEA
ELAAAQRLLARVQEQLSSLWEENQALATHTRDRLAQHEAGLMDLREALNQAVDATREAQE
LNSRNQERLEEALQRKQELSRDNATLKATLHAASDTLASVFRLLHSLDQAKEELERLAAS
LDGARTPLLQRMQTFSPAGSKLRLVEAAEAHAQQLDQLALNLSSIILDINQDRLTQRAIE
ASSAYSRILQAVQAAEDAAGQALQQADHTWATVVQQGLVDRARQLLTNSSALEEAVLREQ
RRLGLVWAALQGAGTQLRDVQAKKDQLEVHIQAAQAMLAMDTDETSKKIAHAKAVAAEAQ
DMATRVQSQLQAMQESVERWQGQYEGLRGQDLGQAVLNAGRSVSSLEKTLPQLLAKLSVL
ENRGAHNASLVLSASIGRVRQLIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYT
ALKFYLQDPEPEPGQGTGDHFVMYMGSRQATGDYMGVSLRDKKVHWVYRLGEAGPAVLSI
DEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGG
YPSTFMPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWL
TDGSYLDGTGFARISFDGQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVREGSLVL
LYDFGAGLREAVPLQTPPPLTSASKAIQVFLLGGSRKRVLVRVERATVFSVEQDNALELA
DAYYLGGAPPHQLPPSLRRLFPMGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLL
VGRAMTFHGHGFLHLALSNVAPLTGDVYSGFGFHSAQDSALLYYRASPDGPCQVSLRQGH
VTLQLLRTEVVAEGGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPEPQPQPEG
PPSLFLGGLPEPDTFHFSGCISNIFVRRLLGPQRVFDLQQNLGSVNVSTGCAPTLQAQTL
DLGPRGLQTAAQKASRRSRQPTQDPACMLPPHLRTTRDTYQFGGSLSSHLEFVGILAPHR
NWPSLSMHVLPRSPRGLLLFAASLRPSSPSLALFLSNGHFVAQMEGLGTRLRAQSRHRSR
PGHWHKVSVRWEKNQILLVTDGARAWSQEGPRQQHQGAEHPQPHTLFVGGLPASSHSSKL
PVTVGFSGCVKRLRLHGKPLGAPTRMAGVTPCISGPLEAGLFFPGSGGVITLDLPGATLP
DVGLELEVRPLAVTGLIFHLGQAQTPPYLQLQVTEKQVLLRADDGAGEFSTSVARPSVLC
DGQWHRLAVMKGGNVLRLEVDAQSNHTVGPSLAAAAAAPAPLHLGGLPEPMAMQPWPPAY
HGCMRRLAVNRSPVTMTDSAEVHGAVGANGCPAI
NT seq 11085 nt   +upstreamnt  +downstreamnt
atggcgaagcggctgtgcgcggggagcgcactgtgtgtccgcggccccccgggccccgcg
ccgctactgctggtcgggctggcgctactgggcacggcgcgggcgcgggaggaggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcgccgcc
tccgcaacctgcggggaggaggccccggcgcgcggctccccgcgccccaccgaggacctt
tactgcaagctggtggggggccccgtggccggcggcgaccccaaccagaccatccagggc
cagtactgtgacatctgtacggctgcgaacagcaacaaggcacacccagcaagcaacgcc
atcgatggcacagagcgctggtggcagagcccacccctgtcccgcggcctggagtacaac
gaggtcaacgtcaccctggacctgggccaggtcttccacgtggcctacgtcctcatcaag
tttgccaactcaccccggccggacctctgggtgctggagcggtccatggacttcggccgc
acctaccagccctggcagttctttgcctcctccaagagggactgtctggagcggtttggg
ccacagactctggaacgcatcacacgggacgacgcggccatctgcaccaccgagtactcg
cgcatcgtgcccctggagaatggagagatcgtggtgtccctggtgaatgggcgcccaggc
gccatgaatttctcctactcgccgctgctgcgtgagttcaccaaggcaactaacgtccgc
ctgcgcttcctgcgcaccaacacgctgctgggccacctcatggggaaggcgctgcgagac
cccacagtcacccgccggtattattacagcatcaaggacatcagcatcggaggccgctgt
gtctgccatggccacgcggacgcctgtgatgccaaagaccccacagacccgttcaggctg
cagtgcacctgccagcacaacacctgcgggggcacctgcgaccgctgctgccccggcttc
aaccagcagccgtggaagcctgcgactgccaacagtgccaatgagtgccagtcctgtaac
tgccacggccacgccaccgactgttactacgaccctgaggtggaccggcgccgtgccagc
cagagcctggatggcacctatcagggcgggggtgtctgtatcgactgccagcaccacacc
accggcgtcaactgtgagcgctgcctgccaggcttctaccgctctcccgaccacccgctt
gactcaccccacgtctgccgccgctgcaactgcgagtccaacttcacggatggcacctgc
gaggacctgacgggtcgctgctactgccggcccaacttctctggggagcggtgcgacgtg
tgtgccgagggcttcacgggcttcccaagttgctacccgacgccctcgtcctccaatgac
accagggagcaggtgctgccagccggccagattgtgaattgtgactgcagcgcggcaggg
acccagggcaacgcctgccggaaggacccgagagtgggacgctgcgtgtgcaaacccaac
ttccgaggcacccattgtgagctctgcgtgccagggttctatggccccggctgccagccc
tgccagtgttccagccctggagtggccgatgaccgctgtgaccctgacacaggccagtgc
aggtgccgagagggcttcgagggggccacatgtgatcgctgtgcccctggctacttccac
ttccctctctgccagttgtgcggctgcagccctgcaggaaccctgcccgagggctgcgac
gaggccggccgctgcccatgccagcatgggtttgctggacctcattgtgaccagtgccac
cctggctaccacggtttccccaactgccaaccgtgcacctgtgatccccggggagccctg
gaccagctctgtggggcaggaggtttgtgccgctgccgccccggctacacaggcaccgcc
tgccaggaatgtagccccagcttccatggcttccccagctgtgtcccctgccactgctct
gccgaaggctccctgcatgcagcctgcgacccccggagtgggcaatgcagctgccggccc
cgcgtgacggggctgcggtgtgacacatgtgtgccaggtgcctacaacttcccttactgc
gaagctggctcttgccaccctgctggtctggctctggcggatcctgcccttcctgaggca
caggctccctgtgtgtgccgagctaacgtggaggggccgagctgtgaccgctgcaaacct
ggattctggggactaagccccagcaaccccgagggctgcacccgctgcagctgtgacccc
aggggcacgctgggtggagttgctgagtgccagccaggcaccggccagtgcttctgcaag
ccccacgtgtgtggccaggcctgtgcagcctgcagggatggcttctttggactggatcag
gctgactatttcggctgccgcagctgccggtgtgacgctggtggtgccttgggccagagc
tgtgaaccgaggacaggcgcctgccggtgccgccccaacacccagggccccacctgcagc
cggcctgcgagggaccactacctcccggacctgcaccacctgcgcctggagctggaggag
gccgccacacctgagggtcacgccgtgcgctttggcttcaaccccctcgagttcgagaac
ttcagctggaggggctatgcgcaaatggcacctgtccagcccaggatcgtggccaggctg
aacctgacttcccccgaccttttctggcttgtcttccgatacgtcaaccggggggccatg
agtgtgagcgggcgggtctctgtgagagaggagggcaggtcggccgcctgcgccaactgc
acagcgcagagccagcccgtggtcttcccgcccagcacagaacctgccttcgtcactgtg
ccccagaggggcttcggagagcccttcgtgctgaaccctggcacctgggccctgcttgtg
gaggctgaaggggtgctcctggactacgtggttctgctgcctagtgcgtactacgaggcg
gcactcctgcagctgcgagtgactgaggcctgcacgtaccgcccctctacccagcagtct
ggcgacaactgcctcctctacacacacctccccctggatggcttcccttcggccgctggg
ttggaggccctgtgtcgccaggacaacagcctgccccggccctgccccacagagcagctc
agcccatcgcacccaccactggtcacctgcacaggcagtgatgtggatgtccagcttcag
gtggcagtgccacagccgggccactacgccctggtggtggagtatgccaatgaggacgcc
cgccaggaggtgggcgtggccgtgcacaccccacagcgggccccccagcaggggctgctc
tccctgcacccctgcctgtacagcaccctgtgccggggcgctgcccgggatacccaggac
cgcctggccgtcttccacctggactcggaggccagcgtgaggctcacagctgaacaggca
cgcttctacctgcacggggtcactctggttcccatggaggagttcagcccagagttcgtg
gagccccgggtccgctgcatcagcagccacggagcctttggtcccagcagtgccgcctgt
ctgccctcgcgcttcccaaagccgccccagcccatcatcctcagggactgccaggtgctc
ccgctgccgcccggcctcccgctgacccacgcacaggacctcatgccagccacgtcccca
actggaccccaacctcggccccccaccgccgtggaccctgatgtggagcccactttactg
catgatccccaggccaccgtggtcttcaccacccatgtgcccacgctgggccgctatgcc
ttcttgctgcatggctaccagccagcccaccccaccttccccgtggaagtcctcatcaac
gccggccgcgtgtggcagggccatgccaacgccagcttctgtccacatggctacggctgc
cgtaccctggtggtgtgtgagggccaggccctgctggacgtgacccacagcgagctcact
gtgactgtgcgtgtgcccgagggccgctggctctggctggattatgtcctcgtggtccct
gagaatgtctacagctttggctacctccgggaggagcccctggacaaatcctatgacttc
atcagccactgcgcagcccagggctaccacatcagccccagcagctcatccctgttctgc
cgaaacgccgctgcctccctctccctcttctataacaacggagcccggccatgtggctgc
cacgaagtaggtgctacaggccccacgtgtgagcccttcgggggccagtgtccctgccgt
gcccacgtcattggccgtgactgctcccgctgcgccaccggatactggggcttccccaac
tgtaggccctgtgactgcggcgcccgcctctgtgacgagctcacgggccagtgcatctgc
ccaccacgcaccgtcccgcccgactgcctgctgtgccagccccagacctttggctgccac
cccctggtcggctgtgaggagtgtaactgctcagggcccggtgtccaggagctcacagac
cctacctgtgacacagacagcggccagtgcaagtgcagacccaacgtgaccgggcgccgc
tgtgatacctgctctccgggcttccatggctacccccactgccgcccctgtgactgtcat
gaggcgggcactgcgcctggtgtgtgtgaccccttcacagggcagtgctactgtaaggag
aatgtgcagggcccccgatgtgaccagtgcagccttgggaccttctccctggatgctgcc
aaccccaaaggttgcacccgctgcttctgttttggggccacggagcgctgccggagctcg
tcctacacccgccaggagttcgtggacatggagggctgggtgctgctgagcactgaccgg
caggtggtgccccacgagcggcggccagggacggagatgctccgtgcagacctgaggcac
gtgcccgaggctgtacctgaggccttccccgagctgtactggcaggccccaccctcctac
ctgggggaccgggtgtcatcctacggtgggaccctccgttatgaactgcactcggagacc
cagcggggagatgtctttgtccccacggagagcaggccggatgtggtgctgcagggcaac
cagatgagcatgacattcctggagccggcacaccccctgcccggccacactcaccgtggg
cagctgcagctggtggaggggaacttccggcacacggagactcgcaacactgtgtcccgt
gaggagctcatgatggtgcttgccagcctggagcagctgcagatccgtgccctcttctcg
cagatctcctcagctgtctccctgcgcagggtggcactggaggtggccagcccagcaggc
caggggaccctggccagcaatgtggagctgtgcctgtgccctgccagctaccggggggac
tcatgccaggaatgtgcccccggcttctatcgggacgtcaaaggtctcttcctgggccga
tgtgtcccttgtcagtgccacggacactcagaccgctgcctccctggctctggcatctgc
gtggactgccagcacaacaccgaaggagcccaatgtgagcgctgccaggctggctttgtg
agcagcagggaggaccccagcgccccctgtgtcagctgcccctgtcccctctcagtgcct
tccaacaacttcgccgagggctgtgtcctgcgaggtggccgcacccagtgcctctgcaaa
cctggttatgcaggcgcctcctgtgagcggtgcgcgcctggcttcttcgggaacccgctg
gtgctgggcagctcctgccagccttgtgactgcagcggcaatggtgaccccaacctgctc
ttcagcgactgcgaccccctgacgggcgcctgccgtggctgcctgcgtcacaccaccggg
ccacgctgcgagatctgtgcccctggcttctatggcaacgccctgctgcccggcaactgc
acccggtgcgactgtgccccatgtgggacagaggcctgcaacccccacagcgggcaatgc
ctgtgcaaggcgggtgtgactgggcggcgctgtgaccgctgtcgggaaggacattttggc
ttcgacggctgcgggggctgccgcccgtgtgcttgtggaccggccgccgagggctccgag
tgccacccccagagcggacagtgccactgccgaccagggaccatgggaccccaatgccgc
gagtgtgcccctggctactgggggttccctgagcagggctgcaggcgctgccagtgccct
gggggccgctgtgaccctcacacgggccgctgcacctgccccccagggctcagtggggag
cgctgtgacacctgcagccagcagcatcaggtgcctgttccaggtgggcctggggaccac
agcgtccactgtgaagtgtgtgaccactgtgtggtcctgctcctggacgacctggaacgg
accggcaccctcctccccgccatccgcgagcaactgcgtggcatcaatgccagctctgtg
gcctgggcccgtctgcacaggctgaacacctccatcactgacctgcagagccagctccgg
agccctctggggccccgccacgagacggcacagcagctggaggtgctggagcagcaaagc
acaagcctcaggcaggatgcacagcagctgggcagccaggcctcggggacccgagaccaa
gcgagccgattgctggctggcaccgaggccacactgggccgggcgaagacgctgttggcg
gccatccgggctgtggaccgcaccctgagcgagctcatgtcccagaccggccacctgggg
ctggccaatgcctcggctctgtcaggcgagcagctgcgccggacgctggccgaggtggag
cggctgctctgggagatgcgggcccgggacctgggggccccgcgggcagccgctgaggct
gagttggctgcagcgcagagattgctggcccgagtgcaggagcagctgagcagcctctgg
gaggagaaccaggcactggccacacacacccgtgaccggctggcccagcatgaggccggt
ctcatggacctgcgagaggccttgaaccaggcagtggacgccacgcgggaggcccaggag
ctcaacagccgcaaccaggagcgcctggaggaagccctgcaaaggaagcaggagctgtcc
cgggacaatgccaccctgaaggccactctgcatgcagctagcgacaccctggccagcgtc
ttcagattgctgcacagcctggaccaggccaaggaggagctggagcgcctcgctgccagc
ctggacggggctcggaccccactgctgcagaggatgcagaccttctccccagcgggcagc
aagctgcgtctggtggaggccgccgaggcccacgcacagcagctggaccagctggcgctc
aacctgtccagcatcatcctggacatcaaccaggaccgccttacccagagggccattgag
gcctccagcgcgtacagccgcatcctgcaggccgtgcaggctgccgaggacgccgctggc
caggccctgcagcaggcagaccacacctgggcgacagtggtgcagcagggcctggtggac
cgagcccggcagctcctgacaaacagcagtgcactggaggaggccgtgctccgggagcag
cggaggctgggccttgtgtgggctgccctccagggtgccgggacccagctccgagatgtc
caggccaagaaggaccaactggaggtgcacatccaggcggcgcaggccatgcttgccatg
gacacagatgagacaagcaagaagatcgcacacgccaaggctgtggccgctgaagcccag
gacatggccacccgtgtgcagtcccagctgcaggccatgcaggagagcgtggagcggtgg
cagggccagtacgagggcctgcggggccaggacctgggccaggcggtgctcaacgcaggc
cgctcagtgtccagcctggagaagacgctgccccagctgctggccaagctgagcgtcctg
gagaaccgtggggcccacaacgccagcctggtcctgtccgccagcatcggccgtgtgcgg
caacttattgcccaggcccggggggctgccagcaaggtcaaggtgcccatgaagttcaac
gggcgctcaggggtgcagctgcgcaccccacgggatcttgccgaccttgctgcctacact
gccctcaagttctacctgcaggacccggagcctgagcctgggcagggtaccggggatcac
tttgtgatgtacatgggcagccgccaggccactggggactacatgggtgtgtctctgcgt
gacaagaaggtgcactgggtgtatcggctgggtgaggcgggccctgcagtcctaagcatc
gacgaggacattggggagcagtttgcagctgtcagcctggacaggactctccagtttggc
catatgtctgtcacagtggagagacagatgatccaggaaaccaagggtgacacggtggcc
cctggggcagaggggctgctcaacctgcggccagacgactttgtcttctacgtcgggggt
taccccagtaccttcatgccccctcccctgcttcgcttccctggctaccggggctgcatc
gagatggacacgctgaacgaggaggtggtcagcctctacaacttcgagaggaccttccag
ctggacacggctgtggacaggccttgtgcccgctccaagtcgaccggggacccgtggctc
acggacggctcctacctggatggcaccggttttgcccgcatcagcttcgatggtcagatc
agcaccaccaagcgcttcgaacaggagctgcgcctcgtgtcctacagtggggtcctcttc
ttcctgaagcagcagagccagttcctgtgcttggccgtgcgagaaggcagcctcgtgctg
ctgtatgactttggcgccggcctgagagaggctgtcccactgcagaccccaccgcccctg
acctcagccagcaaggcgatccaggtgttcctgctggggggcagccgcaagcgtgtgctg
gtacgtgtggagcgggccacggtgttcagcgtggagcaggacaatgctctggaactggcc
gacgcctactacctggggggcgcgccacctcaccagctgcccccgagcctgcgacggctc
ttccccatgggaggctcagtccgtggctgcgtcaaagggatcaaggccctgggcaagtat
gtggacctcaagcggctgaacacgacaggtgtgagtgccggctgcaccgctgacctgctg
gtggggcgtgccatgactttccacggccacggcttccttcacctggcactctcgaacgtg
gcgcccctcactggcgacgtctactccggctttggcttccacagtgcccaggacagtgcc
ctgctctactaccgggcgtccccggatgggccatgccaggtgtccctgcggcagggccat
gtgaccctacagctcctgagaactgaagtggtagctgaggggggcttcgccgatggcgcc
ccccattacgtcgccttctacagcaatgccacaggggtctggctctatgtcgacgaccag
ctccagcagatgaagccccaccggggaccacccccagagccccagccgcagcctgagggg
cccccgagtctcttcctgggaggcctgcctgagcctgacacctttcacttcagtggctgc
ataagcaacatcttcgtgcggcggctcctgggcccacagcgtgtattcgacctgcagcag
aacctgggcagcgtcaacgtgagcacaggctgtgcacccaccctgcaagcccagaccctg
gacctggggcctagaggactgcagaccgccgcccagaaggcctcccgccgcagtcgtcag
cccacccaggatcccgcctgcatgctgcccccacacctcaggaccacccgagacacctac
cagtttgggggttccctgtccagtcacctggagtttgtgggcatcctggccccacatagg
aactggcccagcctctccatgcacgtcctcccgcgaagcccccgtggcctcctgctcttc
gctgctagcctgaggcccagcagcccctccctggcactcttcctgagcaatggacacttc
gtcgcacagatggaaggccttgggactcggctccgcgcccagagccgccatcgctcccgg
cctggccactggcacaaggtctccgtgcgctgggagaagaaccagatcctgctggtgacg
gacggggcccgggcctggagccaggaggggccacgccagcagcaccagggggcagagcac
ccccagccccacaccctctttgtggggggcctcccggccagcagccacagctccaaactt
ccggtgaccgtcgggttcagtggctgtgtgaagagactgaggctgcacgggaagcccctg
ggggcccccacacggatggcaggggtcacaccctgcatctcgggccccctggaggcgggc
ctgttcttcccaggcagcgggggagttatcactttagacctcccaggagctacactgcct
gacgtgggcctggaactggaggtgcggcccctggcagtcaccggcctgatcttccacttg
ggccaggcccagacacccccctatttgcagctgcaggtgactgagaagcaagtcctgctg
cgggcggacgatggagcaggggagttctccacgtcagtggcccgcccctcggtgctgtgt
gacggccagtggcaccggctggcagtgatgaaaggcgggaacgtgctccggctggaggtg
gacgcacagagcaaccacactgtgggcccctcgctggcggctgcggctgctgccccagcc
cctctgcaccttgggggcctgcctgagcccatggccatgcagccctggccccccgcctac
catggctgcatgaggaggctggcagtgaaccggtcccccgtcaccatgactgactctgca
gaggtccacggggcagtgggggccaatggctgcccagccatctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664167
Entry
104664167         CDS       T03989                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104664167 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104664167 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104664167 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664167 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104664167 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104664167 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104664167 (LAMB3)
   05145 Toxoplasmosis
    104664167 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II ATG16 Sec20 UPF0242 F5_F8_type_C Tropomyosin
Other DBs
NCBI-GeneID: 104664167
NCBI-ProteinID: XP_010363916
UniProt: A0A2K6R8H2
LinkDB
Position
8
AA seq 1172 aa
MRPLFLLCFALPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQHG
EWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGNTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQFLPQRP
NARLNGGKVQLNLMDLASGIPATQSKKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTAVQVHDVCVCQHNTAGPNCEHCAPFYNNR
PWRPAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCQDHTEGKNCERCQL
HYFRNRRPGASIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDMPCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPHNSLSPQCNQFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAATGCRACDCDFRG
TEGPGCNKASGHCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRLG
SLRNATTSLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSAAVTEQEVAQVASAILSLRR
ALQGLQPDLPLEEETLSLPRDLESLDRSFNGLLTMYQRKREQFEKLSSADPSGAFRMLTT
AYEQSAQAVQQVSDSSRLLDQLRDSRREAERLAQQAGGGGGTGSPQLVALRLEMSSLPDL
TPTFNKLCGSSRQMACTPGSCPGELCPHDNGTACGSHCRGVLPRAGGAFWTAGQVAEQLR
GFNAQLQQTRQMIRAAEESASQIQSNAQRLETQVSTSRSQMEEDVRRTRLLIQQVRDFLT
DPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARSRAHAVEGQVEDVVGNLQQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQ
VLQPAEKLVTSMTKQLGDFWTRMEELRRQAWQQRAQAVQAQQLAEGASEQALSAQEGFER
IKQKYAELKDRLGQSPTLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI
MLRSADLTGLEKRVEQIRDHINERVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgagaccactcttcctcttgtgttttgccttacctggcctcctgcatgcccagcaagcc
tgctcccgtggggcctgctatccacctgttggggacctgcttgttgggaggacccggttt
ctccgagcttcatctacatgtggactgaccaagcctgagacctactgcacccagcatggt
gagtggcagatgaaatgctgcaagtgtgactccaggcagcctcacaactactacagtcac
cgagtagagaatgtggcttcatcctccggccccatgcgctggtggcagtcacagaatgat
gtgaaccctgtctctctgcagctggacctggacaggagattccagcttcaggaagtcatg
atggagttccaggggcccatgcccgccggcatgctgattgagcgctcctcagacttcggt
aacacctggcgagtgtaccagtacctggctgctgactgcacctccaccttccctcgggtc
cgccagggccggcctcagagctggcaggatgttcggtgccagttcctgccccagaggcct
aatgcacgcctaaatggggggaaggtccaacttaaccttatggatttagcatctgggatt
ccagcaactcaaagtaaaaaaattcaagagctgggggagatcacaaacttgagagtcaac
ttcaccaggctggccccagtgccccaaaggggctaccaccctcccagcgcctactatgcc
gtgtctcagctccgtctgcaggggagctgcttctgtcacggccatgctgatcgctgcgcc
cccaagcctggggcctctgctggcccctccaccgccgtgcaggtccatgatgtctgcgtc
tgccagcacaacactgccggcccaaattgtgaacactgtgcgcccttctacaacaaccgg
ccctggagacctgcagagggccaggacacccatgaatgccaaaggtgcgactgcaatggg
cactcagagacatgtcactttgaccccgctgtgtttgccgccagccagggggcatatgga
ggtgtgtgtgacaattgccaggaccacaccgaaggcaagaactgtgagcggtgtcagctg
cactatttccggaaccggcgcccgggagcttccattcaggagacctgcatcccctgcgag
tgtgatccggatggggcagtgccaggggctccctgtgacccagtgaccgggcagtgtgtg
tgcaaggagcatgtgcagggagagcgctgtgacctatgcaagccgggcttcactggactc
acctacgccaacccgcagggctgccaccgctgtgattgcaacatcctggggtcccggagg
gacatgccgtgtgacgaggagagtgggcgctgcctgtgtctgcccaacgtggtgggcccc
aagtgtgaccagtgcgctccctaccactggaagctggccagtggccagggctgtgaaccg
tgtgcctgcgacccacacaactccctcagcccccagtgcaaccagtttacagggcagtgc
ccctgtcgggaaggctttggtggcctgacatgcagcgctgcagccatccgccagtgtcca
gaccggacctatggagacgcagctacaggatgccgagcctgtgactgtgatttccgggga
acagagggcccaggctgcaacaaggcatcgggccactgcctctgccgccctggcttgact
gggccccgctgtgaccagtgccagcgaggctactgcaaccgctacccggtgtgtgtggcc
tgccacccttgcttccagacctatgatgcagacctccgggagcaggccctgcgccttggt
agcctccgcaatgccaccaccagcctgtggtcagggccagggctggaggaccgtggcctg
gcctcccggatcctagatgcaaagagtaagattgagcagatccgagcagttctcagcagc
gccgcagtcacagagcaggaggtggctcaggtggccagtgccatcctctccctcaggcga
gctctccagggcctgcagccggatctgcccctagaggaggagacgttgtcccttccgaga
gacctggagagtctggacagaagcttcaatggtctcctcactatgtatcagaggaagagg
gagcagtttgaaaaactaagcagtgctgatccttcaggagccttccggatgctgaccaca
gcctacgagcagtcagcccaggctgttcagcaggtctccgacagctcgcgccttttggac
cagctcagggacagccggagagaggcagagaggctggcgcagcaggcgggaggaggagga
ggcaccggcagcccccagcttgtggccttgaggctggagatgtcttcgttgcctgacctg
acacccaccttcaacaagctctgtggcagctccaggcagatggcttgcactccaggatca
tgccctggtgagctgtgtccccatgacaatggcacagcctgtggttcccactgcaggggt
gtccttcccagggccggtggggccttctggacggcagggcaggtggctgagcagctgcgg
ggcttcaatgcccagctccagcagaccaggcagatgattagggcagccgaggaatcagcc
tcgcagattcaatccaatgcccagcgcctggagacccaggtgagcaccagccgctcccag
atggaggaagatgtcagacgcacgcggctcctcatccagcaggtccgggatttcctaaca
gaccccgacactgatgcagccactatccaggaggtcagcgaggctgtgctggccctgtgg
ctgcccacagactcagctaccgttctacagaagatgaacgagatccaggccattgcagcc
aggctccccaacgtggacctggtgctgtcacagaccaagcaggacattgcgcgggcccgc
aggctgcaggctgaggctgaggaagccaggagccgagcccatgcagtggagggccaggtg
gaggatgtggttgggaacctgcagcagggcacagtggcactgcaggaagctcaggacacc
atgcaaggcaccagccgctctcttaggcttatccaggacagggttgctgaggttcagcag
gtactgcagccagcagaaaagctggtgacaagcatgaccaagcagctgggtgacttctgg
acacggatggaggagctccgccgccaagcctggcagcagcgggcacaggcagtccaggcc
cagcagcttgcagaaggtgccagcgagcaggcattgagtgcccaagagggatttgagaga
ataaaacaaaagtatgctgagttgaaggaccggttgggtcagagtcccacgctgggtgaa
cagggtgcccggatccagagtgtgaagacagaggcagaggagctatttggggagaccatg
gagatgatggacaggatgaaagacatggagttggagctgctgcggggcagccaggccatc
atgctgcgctcagcggacctgacaggactggagaagcgtgtggagcagatccgtgaccac
atcaatgagcgtgtgctctactatgccacctgcaagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665145
Entry
104665145         CDS       T03989                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04974  Protein digestion and absorption
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104665145 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104665145 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104665145 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104665145 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    104665145 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665145 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104665145 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104665145 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104665145 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104665145 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104665145 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104665145 (COL4A5)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104665145 (COL4A5)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104665145 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 104665145
NCBI-ProteinID: XP_030790447
LinkDB
Position
7
AA seq 1691 aa
MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGVKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPG
IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDIGPPGPPGLVIPRPGTGITIGEKGN
IGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVVGPPGPPGFPGERGQKGDEGPPGISIPG
PPGLDGQPGAPGLPGPPGPPGPHIPPSYEICEAGPPGPPGSPGDKGLQGEQGIKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGSKGLPGIPGAPGAPGF
PGSKGEPGDILTFPGMKGDKGDLGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKG
ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQAIT
QPGKPGLPGNPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGTLGPKGDRGFP
GPPGPPGRTGVDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG
IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGSIGPPGSPGLPGKAGASGFPGTKGEMGM
MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPAGEKGSKGEPGLPGPPGPMDPNLL
GSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLI
GPPGLKGTIGDMGFPGPQGVEGPPGPPGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGLPGTPGPPGPKGISGPPG
NPGLPGETGPVGGGGRPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGPPGPALEGPKGNPGPQGPP
GRPGPTGFQGLPGPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRP
GLNGMKGDPGLPGVPGFPGMKGPSGIPGSAGPEGEPGLTGPPGPPGLPGPSGQSIIIKGD
AGPPGIPGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGT
RGLDGPPGPDGLQGPPGPPGTSSIAHGFLITRHSQTTDAPQCPQGTLQIYEGFSLLYVQG
NKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPVSMQPLKG
QSIQPFISRCAVCEAPAVVIAVHSQTIQIPRCPQGWDSLWIGYSFMMHTSAGAEGSGQAL
ASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTR
ISRCQVCMKRT
NT seq 5076 nt   +upstreamnt  +downstreamnt
atgaaactgcgtggagtcagcctggctgccggcttgttcttactggccctgagtctttgg
gggcagcctgcagaggctgcggcttgctatgggtgttctccaggatcaaagtgtgactgc
agtggcgtaaaaggggaaaagggagagagagggtttccaggtttggaaggacacccagga
ttacctggatttccaggtccagaagggcctccagggcctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaaggaatcagaggtcctcctggacttcctggattt
ccagggacaccaggtcttcctggaatgccaggccatgatggggccccaggacctcaaggt
attcctggatgcaatggaaccaagggagaacgtggatttccaggcagtcccggttttccc
ggtttacagggtcctccaggaccccctgggatcccaggtatgaagggtgaaccaggtagt
ataattatgtcatcactgccaggaccaaagggtaatccaggatatccaggtcctcctgga
atacaaggcctacctggtcccactggtataccagggccaattggtcccccaggaccacca
ggtttgatgggccctcctggtccaccaggacttccaggaccaaaggggaatatgggctta
aatttccagggacccaaaggtgaaaagggtgagcaaggtcttcagggcccacctgggcca
cctgggcagatcagtgaacagaaaagaccaattgatgtagagtttcagaaaggagatcag
ggacttcctggtgaccgagggcctcctggacctccagggatacgtggtcctccaggtccc
ccaggtggtgagaaaggtgagaagggtgagcaaggagagccaggcaaaagaggtaaacca
ggcaaagatggagaaaatggccaaccaggaattcctggtttgcctggtgatcctggttac
cctggtgaacccggaagggatggtgaaaagggccaaaaaggtgacattggcccacctgga
cctcctggacttgtaattcctagacctgggactggtataactataggagaaaaaggaaac
attgggttgcctggcttgcccggagaaaaaggagagcgaggatttcctggaatacagggt
ccacctggccttcctggacctccaggggctgcagttgtgggtcctcctggccctcctgga
tttcctggagaaaggggtcagaaaggtgatgaaggaccacctggaatttccattcctgga
cctcctggacttgatggacagcctggggctcctgggcttccagggcctcctggccctcct
ggacctcacatccctcctagttatgagatatgtgaagcaggccctccaggccccccagga
tctccaggtgataaaggactccaaggagaacaaggaattaaaggtgacaaaggtgacact
tgcttcaactgcattggaactggtatttcagggcctccaggtcaacctggtttgccaggt
ctcccaggtcctccaggatcccttggtttccctggacagaaaggtgaaaaaggacaagct
ggtgcaactggttccaaaggattaccaggcattccaggagctccaggtgctccaggcttt
cctggatctaaaggtgaacctggtgatatcctcacttttccaggaatgaagggtgacaaa
ggagatttgggttcccctggagctccagggcttcctggtttacctggcactcctggacag
gatggattgccaggacttcctggcccgaaaggagagcctggtggaattacttttaagggt
gaaagaggtccccctgggaacccaggtttaccaggcctcccagggaatatagggcctatg
ggtcctcctggttttggccctccaggcccagtaggtgaaaaaggcatacaaggtgtggca
ggaaatccaggccagccaggaataccaggtcctaaaggggatccaggtcaggctataacc
cagccagggaagcctggcttgcctggtaacccaggcagagatggtgaagtaggtcttcca
ggtgaccctggactcccagggcaaccaggcttgccagggatacctggtagcaaaggagaa
ccaggtatccctggaattgggcttcctggaccacctggtcctaaaggctttcctggaatt
ccaggacctccaggagcacctgggacacctggaagaattggtctagaaggccctcctggg
ccacctggctttccaggaccaaagggtgaaccaggatttgcattacctgggccacctggg
ccaccaggacttccaggtttcaaaggaacacttggtccaaaaggtgatcgtggtttccca
ggacctccaggtcctccaggacgcactggcgtagatgggctccctggaccaaaaggtgat
gttggaccaaatggacaacctggaccaatgggacctcctgggctgccaggaataggtgtt
cagggaccaccaggaccaccagggattcctgggccaataggtcaacctggtttacatgga
ataccaggagagaagggggatccaggacctcctggacttgatgttccgggacccccaggt
gaaagaggcagtccagggatccctggagcacctggttctataggacctccaggatcacca
gggcttccaggaaaagcaggtgcctctggatttccaggtaccaaaggtgaaatgggtatg
atgggacctccaggcccaccaggacctttgggaattcctggcaggagtggtgtacctggt
cttaaaggtgatgatggcttgcagggtcagccaggacttcctggccctgcaggagaaaaa
ggtagtaaaggagagcctggccttccaggccctcctggaccaatggatccaaatcttctg
ggctcaaaaggagagaagggggagcctggcttaccaggtatacctggagtttcagggcca
aaaggttatcagggcttgcctggagacccagggcaacctggactgagtggacaacctgga
ttaccaggaccaccaggtcccaaaggtaaccctggtctccctggacagccaggtcttata
ggacctcctggacttaaaggaaccatcggcgacatgggttttccagggcctcagggtgtg
gaagggcctcctggacctcccggagttcctggacagcctggctccccaggattacctgga
cagaaaggcgacaaaggtgatcctggtatttcaagcattggtcttccaggtcttcctggt
ccaaagggtgagcctggtctgcctggatacccagggaaccctggtatcaaaggttctgtg
ggagatcctggtttgcctggattaccaggaacccccggagcaaaaggacaaccaggcctt
cctggactcccaggaaccccaggccctcctggaccaaaaggtattagtggccctcctggg
aaccctggccttccaggagaaactggtcctgtaggtggtggaggtcgtcctgggcaacca
gggcctccaggcgaaaaaggcaaacccggtcaagatggtattcctggaccagctggacag
aagggtgaaccaggtcaaccaggctttggaaacccaggaccccctggacttccaggactt
tctggccaaaagggtgatggaggattacctggaattccaggaaatcctggccttccaggt
ccaaagggcgaaccaggctttcacggtttccctggtgtgcagggtcccccaggccctcct
ggtcctccgggtccagctctggaaggacctaaaggcaaccccgggccccaaggtcctcct
gggagaccaggtcctacaggttttcaaggtctaccaggtccggaaggtcccccgggtctc
cctggaaatggaggtattaaaggagagaagggaaacccaggccaacctgggctacctggc
ttgcctggtttgaaaggagatcaaggaccaccaggactccagggtaatcctggtcggccg
ggtctcaatggaatgaaaggagatcctggtctccctggtgttccaggattcccaggcatg
aaaggacccagtggaatacctggatcagctggtcctgaaggggaaccgggacttaccggt
cctccaggtcctcctggattacctggtccttcaggacagagtatcataatcaaaggagat
gctggtcctccaggaatccctggacaacctgggttgaaaggtctaccaggaccccaagga
cctcaaggtttaccaggtccaactggccctccaggagatcctggacgcaatggactccct
ggctttgatggtgcaggagggcgcaaaggagacccaggtctgccaggacagccaggtacc
cgtggtttggatggtccccccgggccagatggattgcaaggtcccccaggtccccccgga
acctcctctattgcacatggatttcttattacacgccacagccagacaacggatgcacca
caatgcccacagggaacacttcagatctatgaaggcttttctctcctgtatgtacaagga
aataaaagagcccatggtcaagacttggggacagctggcagctgccttcgtcgctttagt
accatgcctttcatgttctgcaacatcaataatgtttgcaactttgcttcaagaaatgac
tattcttactggctgtctaccccagagcccatgccagtgagcatgcaacccctaaagggc
cagagcatccagccattcattagtcgatgtgcagtatgtgaagctccagctgtggtaatc
gcagttcacagtcagacgatccagattccccgttgtcctcagggatgggattctctgtgg
attggttattccttcatgatgcatacaagtgcaggggcagaaggctcaggtcaagcccta
gcctctcctggttcctgcttggaagagtttcgttcagctcccttcatcgaatgtcatggg
aggggtacctgtaactactatgccaactcctacagcttttggctggcaactgtagatgtg
tcagacatgttcagtaaacctcagtcagaaacgctgaaagcaggagacttgaggacacga
attagccgatgtcaagtgtgcatgaagaggacataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666795
Entry
104666795         CDS       T03989                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05020  Prion disease
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104666795 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104666795 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104666795 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666795 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104666795 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    104666795 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104666795 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104666795 (LAMC1)
   05145 Toxoplasmosis
    104666795 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 104666795
NCBI-ProteinID: XP_010367229
UniProt: A0A2K6NS10
LinkDB
Position
8
AA seq 1608 aa
MRGSQRAAPALRRRRRLWPVLVVLAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCSGRSQECYFDPELYRST
GHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCTCSGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGGNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLSPLDSETLENEANNIKMEAENLERLIDQKLKDYEDLREDMRGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILSNLKDFDRRVNDNK
TAAEEALRKIPAINQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4827 nt   +upstreamnt  +downstreamnt
atgagggggagccagcgggccgcgccggccctgcggcgccggaggcggctctggcccgtg
ttggtcgtgctggccgccgccgcggcgggctgtgcccaggcagccatggacgagtgcacg
gacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtg
accgtggtggctaccaacacgtgtgggactccgcccgaggagtactgtgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccag
accatgctggctggggtgcagtaccccagctccatcaacctcacgctgcacctgggaaaa
gcttttgacatcacctacgtgcgtctcaagttccacaccagccgcccagagagctttgcc
atttacaagcgcacgcgggaagatgggccctggatcccttaccagtactacagtggttcc
tgcgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgagcag
caggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaacgtggcc
ttttctaccctggaaggaaggccaagtgcctataactttgacaatagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttggagat
gaagtgtttaacgatcccaaagttctcaagtcctattattatgcgatctctgattttgct
gtgggtggcagatgtaaatgtaatggacacgcaagcgagtgtatgaagaacgaatttgat
aagctggtgtgtaactgcaaacataacacatatggagtagactgtgaaaagtgtcttcct
ttcttcaatgaccggccatggaggagggcaactgcggaaagtgccagtgaatgcctgccc
tgtgactgcagtggtcgatcccaggaatgctacttcgaccctgaactctatcgttctact
ggccatgggggtcactgtaccaactgccaggataacacagatggcgcccactgtgagagg
tgccgggagaacttcttccgccttggaaacaatgaagcctgctctccatgccactgtagt
cctgtgggctctctaagcacacagtgtgatagttacggcagatgcagctgtaagccagga
gtaatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaggcagga
tgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatgttgaaacagga
agatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctggattt
tttaatctggaatcatctaatcctaggggttgcacaccctgcttctgctttgggcattct
tctgtctgtacaaatgctgttggctacagtgtttattctatctcctctacctttcagatt
gatgaggatgggtggcgtgtggaacagagagatggctctgaagcatctctcgaatggtcc
tctgagaggcaagatattgccgtgatctcagacagctactttcctaggtacttcattgct
cctgcaaagttcttgggcaagcaggtgttgagttatggtcagaacctctccttctccttt
cgagtggacaggcgagatactcgcctctctgcagaagaccttgtgcttgagggagctggc
ttaagggtatctgtgcccttgatcgctcagggcaattcctatccaagtgagaccactgtg
aagtatgtcttcaggctccatgaagcaacagattacccttggaggcctgctcttacccct
tttgaatttcagaagctcctaaacaacttgacctctatcaaaatccgtgggacatacagt
gagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcctgga
gtccctgcaacttgggtggagtcctgcacctgtcctgtgggatatggagggcagttttgt
gagatgtgcctttcaggttacagaagagaaactcctagtcttggaccatacagtccatgt
gtgctttgcacctgcagtggacacagcgagacctgtgatcctgagacaggtgtttgtaac
tgcagagacaatacggctggcccgcactgtgagaagtgcagtgatgggtactatggggat
tcaactgcgggaacctcctctgattgccagccctgtccgtgtcccggaggctcaagttgt
gctgttgtccccaagacaaaagaggtggtgtgcaccaactgtcctactggcaccactggt
aagagatgtgagctctgtgatgatggctactttggagaccccctgggtggaaacggccct
gtgagactttgccgcctgtgccagtgcaatgacaacatcgatcccaacgcagttgggaat
tgcaatcgtttgacaggagaatgcctgaagtgcatctataatactgctggcttctattgt
gaccggtgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaatgc
aaagcctgcaattgcaatccgtatgggacagtgaagcagcagagcagctgtaaccccgtg
acggggcaatgtgaatgtttgcctcacgtgactggccgggactgtggtgcttgcgaccct
ggattctacaacctgcagagtgggcaaggctgtgagaggtgtgactgccatgccttgggc
tccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcctggcatcacc
ggtcagcactgtgagcgttgtgaggtcaaccactttgggtttggacctgaaggctgcaaa
ccctgtgactgtcatcccgaggggtctctttcacttcagtgcaaagacgatggtcgctgt
gaatgcagagaaggctttgtgggaaatcgctgtgaccagtgtgaagaaaactatttctac
aaccggtcttggcctggctgccaggaatgtccagcttgttaccgtttggtaaaggataag
gttgctgatcatcgagtgaagctccaggaattagagagtctcatagcaaaccttggaact
ggggatgagatggtgacggatcaagccttcgaggatagactaaaggaagcagagagggaa
gttatggacctccttcgtgaggcccaagatgtcaaagatgttgaccagaatttgatggat
cgcctacagagagtgaataacactctgtccagccaaattagccgtttacaaaatatccgg
aataccattgaagagactggaaacttggctgaacaagcacgtgcccatgtagagaacaca
gagaggttgattgaaatcgcgtccagagaacttgagaaagcaaaagtcgctgctgccaat
gtgtcagtcactcagccagaatctacaggggacccaaacaacatgactcttttggcagaa
gaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtggca
aagacagccaatgatacatcaactgaggcatacaacctgcttttgaggacattggcagga
gaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagcgaagaac
atctcacaggatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggccggt
gacaaagctgtggagatctatgccagcgtggctcagctgagccctttggactctgagaca
ctggagaatgaagcaaataacataaagatggaagctgagaatctggaacgtctgattgac
cagaaattgaaagattatgaggacctcagagaagacatgagagggaaggaacttgaagtc
aagaaccttctggagaaaggaaagactgaacagcagaccgcagaccaactcctagcccga
gctgatgctgccaaggccctcgccgaagaagctgcaaagaagggacgtgataccttacaa
gaagctaatgacattctcagcaacctgaaagattttgataggcgcgtgaacgataacaag
acagccgcagaggaggcactaaggaagattcctgccatcaaccagaccatcattgaagcc
aatgaaaagaccagggaagcccagcaggccctgggcaacgctgcggcggacgccacagag
gccaagaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgccacc
agcaccaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgaggtg
aacaatatgttgaagcaactacaggaagcagaaaaagagctaaagagaaaacaagatgat
gctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgagatc
aatgccagaaaagccaagaactctgttactagcctcctcagcattattaatgacctcttg
gaacagctggggcagctcgacacagtggacctgaataagctaaacgagattgaaggcacc
ctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgacctg
gagaatgaagccaagaagcaggaggctgccatcatggactataatcgagatatcgaggag
atcatgaaggacattcgcaatctggaagacatcaggaagaccttaccatctggctgcttc
aacaccccgtccattgaaaagccctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666798
Entry
104666798         CDS       T03989                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104666798 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104666798 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104666798 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666798 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104666798 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104666798 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104666798 (LAMC2)
   05145 Toxoplasmosis
    104666798 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 104666798
NCBI-ProteinID: XP_010367231
UniProt: A0A2K6RWZ8
LinkDB
Position
8
AA seq 1193 aa
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDQELYRQTGNGFRCLNCNDNT
DGIHCERCKDGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDRGN
PEGCTQCFCYGHSASCRSSADYSVHKITSTFNQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSARRPDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTLRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSAKLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPAEKCRACNCNPMGSEPVECRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGAVLDTELEGRMQQAEQAL
RDILRDAQISEGASRSLGLQLAKVRSQENSYRSRLDDLKMTVERVRALGSQYQNQVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTK
ETEDYSKQALSLVHKALREGGGSGSGNRDGAVVQGVVEKLEKTKSLAQQLTREATQAETE
ADRSYQHSLRLLDSVSQLQGVNDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRAQKNLG
DWEEETQQLLQNGKNGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTRQAERALGSAAADAQRAKNGAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKTEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNTGVTIQDTLNTLDGLLHLMDQPVSVDEEGLILLEQKLSRAKNQINSQLRP
MMSELEERARRQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTPVLEQQ
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctgggctgctgcctctgcttctcgctcctcctgcccgcagcccgg
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcagtgtatctttgat
caggaactttacagacaaactggtaatggattccgctgcctcaactgcaatgacaacact
gatggcattcactgcgagaggtgcaaggacggcttttaccggcacagagaaagggaccgc
tgtttgccctgcaattgtaactccaaaggttctcttagtgctcgatgtgacaactccgga
cggtgcagctgtaaaccgggtgtgacaggagccagatgcgaccgatgtctgccaggcttc
cacatgctcacggatgcggggtgcacccaagaccagagactgctagactccaagtgtgac
tgtgacccagctggcatcgcagggccctgtgacgcgggccgctgtgtctgcaagccagct
gtcactggagaacgctgtgataggtgtcgatcaggttactataatctggatcgggggaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccgcagctctgca
gactacagtgtccataagatcacctctacctttaatcaagatgttgatggctggaaggct
gtccaacgaaatgggtctcctgcaaagctccaatggtcgcagcgccatcaagatgtgttt
agctcagcccgacgaccagaccctgtctattttgtggctcctgccaaatttcttgggaat
caacaggtgagctatgggcaaagcctgtcctttgactaccgtgtggacagaggaggcaga
cacccatctgcccacgatgtgatcctggaaggtgctggtctacggatcacagctcccttg
atgccacttggcaagacactgccttgtgggctcaccaagacttacacactcaggttaaat
gagcatccaagcagtaattggagcccccagctgagttactttgagtatcgaaggttactg
cggaatctcacagccctccgcatccgagctacatatggagaatacagtactgggtacatt
gacaatgtgaccctgatttcagcccgacccgtctctggagccccggcaccctgggttgaa
cagtgtatatgtcctgttgggtacaaggggcaattctgccaggattgtgcttctggctac
aagagagattcagcaaaactggggccttttggcacctgtattccttgtaactgtcaaggg
ggaggggcctgtgatccagacacaggagattgttattcaggggatgagaatcctgacatt
gagtgtgctgactgcccaattggtttctacaatgatccacacgacccccgcagctgcaag
ccatgtccctgtcataacgggttcagctgctcagtgatgccagagacagaggaggtggtg
tgcaataactgccctcccggggtcaccggtgcccgctgtgagctctgtgctgatggctac
tttggggacccctttggtgaacatggcccagtgaggccttgtcagccctgtcaatgcaac
aacaatgtggaccccagtgcctctgggaactgtgaccggctgacaggcaggtgtctgaag
tgtatccacaacacagccggcatctactgcgaccagtgcaaagcaggctacttcggggac
ccgttggctcccaatccagcagaaaagtgtcgagcttgcaactgcaaccccatgggctca
gagcctgtagaatgtcgaagtgatggcacctgtgtttgtaagccaggatttggtggcccc
aactgtgagcacggagcattcagctgtccagcttgctataatcaagtgaagattcagatg
gatcagtttatgcagcagcttcagagaatggaggccctgatttcaaaggctcagggtggt
gatggagcagtacttgatacagagctggaaggcaggatgcagcaggctgagcaggccctt
cgggacattctgagagatgcccagatttcagaaggtgctagcagatcccttggtctccag
ttggccaaggtgaggagccaagagaacagctaccggagccgcctggatgacctcaagatg
actgtggaaagagttcgggccctgggaagtcagtaccagaaccaagttcgggatactcac
aggctcatcactcagatgcaactgagcctggcagaaagtgaagcttccttgggaaacact
aacattcctgcctcagaccactacgtggggccaaatggctttaaaagtctggctcaggag
gccacgagattagcagaaagccacgttgagtcggccagtaacatggagcaactgacaaaa
gaaactgaggactattccaaacaagccctctcactggtgcacaaggccctccgtgaagga
ggcggaagcggaagcggtaaccgggacggtgctgtggtgcagggggttgtggaaaaattg
gagaaaaccaagtccctggcccagcagttgacaagggaggccactcaagcggaaactgaa
gcagataggtcttatcagcacagtctccgcctcctggattcagtgtctcagcttcaggga
gtcaatgatcagtcctttcaggtggaagaagcaaagaggatcaaacaaaaagctgattca
ctctcaagcctggtgaccaggcatatggatgagttcaaacgtgcacaaaagaatctggga
gactgggaagaagaaacacagcagctcttacagaatggaaagaatgggagagagaaatca
gatcagctgctttcccgtgccaatcttgctaaaagcagagcacaagaagcactaagtatg
ggcaatgccactttttatgaagttgagagcatccttaaaaacctcagagagtttgacctg
caggtggacaacagaaaagcagaagctgaagaagccatgaagagactctcctacatcagc
cagaaggtttcagacgccagtgacaagacccggcaagcagaaagagccctggggagtgct
gctgctgacgcacagagggcaaagaatggggccagggaggccctggagatctccagtgag
attgaacaggagattgggagtctgaacttggaagccaatgtgacagcagatggagccttg
gccatggaaaagggactggcctctcttaagactgagatgagggaagtggaaggagagctg
gaaaggaaggagctggagtttgacacgaatatggatgcagtacagatggtgattacagaa
gcccagaaggttgacaccagagccaagaacactggggttacaatccaagacacactcaac
acattggatggcctcctgcatctgatggaccagcctgtcagtgtagatgaagaggggctg
atcttattggagcagaagctttcccgagccaagaaccagatcaacagccaactgcggccc
atgatgtcagagctggaagagagggcacgtcggcagaggggccacctccatttgctggag
acaagcatagatgggattctggctgatgtgaagaacttagagaacattagggacaaccta
cccccaggctgctacaataccccggttcttgagcaacagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667469
Entry
104667469         CDS       T03989                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2
  KO
K06243  laminin, beta 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104667469 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104667469 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104667469 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667469 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104667469 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104667469 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104667469 (LAMB2)
   05145 Toxoplasmosis
    104667469 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Sec5
Other DBs
NCBI-GeneID: 104667469
NCBI-ProteinID: XP_010368201
UniProt: A0A2K6QAI5
LinkDB
Position
1
AA seq 1798 aa
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KVTNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLATGRGCDRCLPGHWGLSHDLLGCRLCDCDVGGALDPQCDEATGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLREGQALEFLVASVPKAMDYDLLLRLEPQVPEQWAELELTVQRPGPVPAHSLCGHVLPK
DDHIQGTLQPHARYIVFPNPVCLEPAISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRALVLEMFSGGDAAALERRATFERYQCQEEGLVPSKTSPSEACAPLLLSLSTLIYNGA
LSCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCPCRTGAFGLHCDRCQRGQWGFPNCRPCVCNGHADECDTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQKIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDHCA
PNFWNFTSGHGCHPCACHPRQARGPTCNEFTGQCYCRAGFGGRTCSECEELHWGDPGLQC
RACDCDPRGTDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGFFPACHPCHACFGDWDRV
VQDLAARTRRLEQRTQELQQTGVLGAFESSFWHIQERLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERCANTSALAVPSPVSNSASARHRTEALMDAQNEDFN
SKHMANQRALGKLSARTHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELRELVQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVQSLADVDAILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGV
AQGAIQGAVADTRDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQSAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt   +upstreamnt  +downstreamnt
atggagctgacctcaagggaaggagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggccgccacactggcacaggcccctgccccggatgtgcct
ggctgttcgaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacctgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggatgaaaagaagtgcttcctttgcgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaacgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccaactggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccctccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgttggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aaggtcaccaacctacgggtgaacctgactcgtctacacacattgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctatggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgaacagtgtcaggatttctatcatgacctgccctggcatccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gctgtatacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggc
ggtcgctgtgattcccatgatgaccctgcactgggactggtctcgggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccaacaatgccgtgatggcttctttgggctcagc
atcagtgaccctctgggctgccggcgatgtcaatgtaatgcacggggcacggtgcctggg
agtactccttgtgaccccaacagtggatcctgttattgcaaacgtctagcgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgc
ctctgtgactgcgacgtgggtggtgccttggatccccagtgtgatgaggccacaggtcaa
tgccactgccgccagcacatggtcgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaacttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggttactcccggggaaactccatcctggactggctcaggctttgtg
cggctacgggagggtcaggccctggagttcctcgtggcctctgtgccgaaggccatggac
tatgacctgctgctgcgcttagaaccccaggtccctgagcaatgggcagagttggaactg
actgtgcagcgtccagggcctgtgcctgctcacagcctgtgtgggcatgtgctgcccaag
gatgaccacatccaagggactctgcaaccacacgccaggtacatagtgtttcccaatcct
gtctgccttgagcctgctatctcctacaagctgcatctgaagctggtacgcacaggggga
agtgcccagcctgagactccctactctggacctggcctgctcattgactcgctggtgctg
ctgccccgtgccctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgc
cgggccacctttgaacgctaccaatgccaggaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcgcccctcctcctcagcctgtccaccctcatctacaatggtgcc
ctgtcatgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggcggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccacgagggggcgctcagc
agtctctgtgaaaagaccagtgggcaatgtccctgtcgaactggtgcctttgggcttcac
tgtgaccgctgccagcgtggccagtggggattccctaactgccggccatgtgtctgcaat
gggcatgcagatgagtgcgacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccatggggacccacgactgccatat
gggggccagtgccggccctgtccatgtcctgaaggtcctgggagccagcggcactttgct
acttcttgccaccgggatgaatattcccagaagattgtgtgccactgccgggcaggctac
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccacgggcaggctgcccgacagagctgtcaccgctgcacctgc
aacctgctgggcacaaatccccagcagtgcccgtctcctgaccagtgccactgtgatcca
agcagtgggcagtgcccatgcctccccaatgtccagggccctagttgtgaccactgtgcc
cccaacttctggaacttcaccagcggccatggttgccatccttgtgcctgccacccaaga
caggccagaggccccacctgcaatgagttcacagggcagtgctactgccgtgccggcttt
ggagggcggacttgttctgagtgcgaagagctccactggggagaccctgggttgcagtgc
cgtgcctgtgattgtgaccctcgtggaacagataaacctcagtgtcaccgctccacaggt
cactgcagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgcccgtggcttc
tcaggattctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggctgcccgtacacggcgcctagagcagcggacacaggagttgcagcag
acgggtgtgctgggtgcctttgagagcagcttctggcatatacaggagaggctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattggggaggccactgagcacctgactcaactggag
gcagagctgacagatgtgcaggatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagacaggcttgcacttaatctcacactgcggcagctggaccagcatcttgacttg
ctcaaacattcaaacttcctaggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgttgtgccaacacctcggccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgcccagaatgaggacttcaac
agcaaacacatggccaaccagcgagccctgggcaagctctctgcccgtacccacaccctg
agcctgacaggcataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccccgctgtgggggcctc
agctgcaatggggcagcggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagtgaggcacagcagcgggcccaggcagctctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcgagaacttgtccagagtgtgaag
gacttcctcaaccaggagggggctgatcctgatagcattgagatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgca
gagcgagtccagagcctggcggatgtggacgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagttactgcaggatgcacggcgggcaaggagccgggctgagggtgag
aaacagaaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtgtt
gcccagggtgccatccagggggcagtggctgacacacgggacacagagcagaccctatac
caggtacaggagaggatggcaggtgcagagcaggcactgagctctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaagttgaaacgggcgggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacggggccctctgggtgatcagtaccagacggtgaaggccctggctgagcgcaag
gcccagggtgtgctagctgcacaggcaagggcagagcaactgcgggatgaggctcgggac
ctgttgcagtccgctcaggacaagctgcagcggctacaggaactggaaggcacctatgag
gagaatgagcgggcactggagggtaaggcagcccagctggacgggctggaggccaggatg
cgcagtgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669238
Entry
104669238         CDS       T03989                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104669238 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104669238 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104669238 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104669238 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669238 (FN1)
   05205 Proteoglycans in cancer
    104669238 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104669238 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104669238 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104669238 (FN1)
   05100 Bacterial invasion of epithelial cells
    104669238 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104669238 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104669238 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104669238 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104669238 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104669238 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104669238 (FN1)
Membrane trafficking [BR:rro04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    104669238 (FN1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   104669238 (FN1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104669238 (FN1)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   104669238 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 104669238
NCBI-ProteinID: XP_010370466
LinkDB
Position
14
AA seq 2389 aa
MLRGPGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKH
YQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDS
MIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWT
CKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRT
SYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVRAAVYQPQP
HPQPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGE
PCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGA
LCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMY
RIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEG
HMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWH
CQPLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEAT
IPGHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPL
SPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIP
DLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPI
TGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQET
TGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPTSR
NTFAEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWT
PPRAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKA
TGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSI
VVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERS
TTPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVP
ISDTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISP
SDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHW
IAPRATITGYRIRHHPEHYSGRPREDRVPPSRNSITLTNLTPGTEYVVSIVALNGREESP
LLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPG
SKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSI
SVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPS
GESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFP
APDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSL
SAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDT
LTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQ
RTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNS
LLVSWQPPRARITGYIIKYEKPGSSPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKN
NQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITHPGYDTGNGIQLPG
TSGQQPTVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHL
YPHGLGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSAT
LTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVG
DEWERMSESGFKLLCHCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTC
LGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGG
EPSPEGTTGQSYNQYSQRYHQRTNTVSALAPRVCFLILDSPFYRHLSSE
NT seq 7170 nt   +upstreamnt  +downstreamnt
atgctcaggggtccgggcccggggcccgggctgctgctgctggccgtcttgtgcctgggg
acagcggtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatggttcag
ccccagtccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacac
tatcagataaatcaacagtgggagcggacctacctgggcaatgccttggtttgtacttgt
tatggaggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgcttt
gacaagtacactggaaacacttaccgagtgggtgacacttacgagcgtcctaaagactcc
atgatctgggactgtacctgcatcggggctgggcgagggagaataagctgcaccatagca
aaccgctgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacac
gagactggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacc
tgcaagcccatagctgagaaatgttttgatcatgctgctgggacttcctatgtggtcgga
gaaacctgggagaagccctaccaaggctggatgatggtagattgtacttgcctaggagaa
ggcagcggacgcatcacttgcacctctagaaatagatgcaatgatcaggacacgaggacg
tcctatagaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgc
atctgcacaggcaacggccgaggagagtggaagtgtgagaggcacaccactgtgcagacc
acatcgagcggatctggccccttcaccgatgttcgtgcagctgtttaccaaccgcagcct
cacccccagcctgccccctatggccactgtgtcacagacagtggtgtgatctactctgtg
gggatgcagtggctgaagacacaaggaaataagcaaatgctttgcatgtgcctgggcaac
ggagtcagctgccaagagacagctgtaacccagacatacggtggcaactcaaatggggag
ccatgtgtcttaccattcacctacaacggcaggacgttctactcctgcaccacagaaggg
cgacaggacggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatat
tctttctgcacggaccatactgttttggttcagactcgaggaggaaattccaatggtgcc
ttgtgccacttccccttcctatacaacaaccacaattacactgattgcacttctgagggc
aggagagacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagttt
ggattctgccccatggctgcccatgaggaaatctgcacaaccaatgaaggggtcatgtac
cgcattggagatcagtgggataagcagcatgacatgggccacatgatgaggtgcacgtgt
gttgggaacggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgc
attgttgatgacatcacttacaatgtgaatgacacattccacaagcgtcatgaagaggga
cacatgctgaactgtacatgcttcggtcagggtcggggcagatggaagtgtgatcccgtc
gaccaatgccaggattcagagactgggacattttatcaaattggagattcatgggagaag
tatgtgcatggtgtcagataccagtgctactgctatggccgtggcattggggagtggcat
tgccaacctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgag
actccgagtcagcccaactctcaccccatccagtggaatgcaccacagccatctcacatt
tccaagtacattctcaggtggaggcctaaaaattctgtaggccgttggaaggaagctacc
ataccaggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgag
ggccagctcatcagcatccagcagtacggccaccgagaagtgactcgctttgacttcacc
accactagcaccagcacacctgtgaccagcaacaccgtgacaggagagacaactcccctt
tctccccttgtggccacttctgaatctgtcactgaaatcacagccagcagctttgtggtc
tcctgggtctcagcttctgacaccgtgtcgggattccgggtggaatatgagctgagtgag
gagggagatgagccacagtatctggatcttccaagcacagccacttccgtgaacatccct
gacctgcttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggag
cagagtttgatcctgtctacttcacaaacaacagcgcccgatgcccctcctgaccctact
gtggaccaagttgatgacacctcaattgttgttcgctggagcagaccccaagctcccatc
acagggtacagaatagtctattcaccatcagtagaaggcagcagcacagaactcaacctt
cctgaaactgcaaactccgtcaccctcagtgacttgcaacctggcgtccagtataatatc
actatctatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaacc
actggcaccccacgttcagatacagtgccctctcccagggatctgcagtttgtggaagtg
acagacgtgaaggtcaccatcatgtggacaccgcctgagagtgcggtgaccggctaccgc
gtggatgtgatccccgtcaacctgcctggggagcacgggcagaggctgcccaccagcagg
aacaccttcgcagaagtcaccgggttgtcccctggggtcacgtattacttcaaagtcttt
gccgtgaaccacgggagggagagcaagcctctgactgccgaacagacaaccaaactggac
gctcccactaacctccagtttgtcaatgaaacggattctactgtcctggtgagatggact
ccacctcgggcccagataacaggataccgactgactgtgggcctgacccgaagaggccaa
cccaggcagtacaatgtgggtccctctgtctcgaagtacccactgaggaatctgcagcct
ggatctgagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagcc
actggagtctttaccacactgcagcctgggagctccattccaccttacaacaccgaggtg
actgagaccaccattgtgatcacatggacacctgctccaagaattggttttaagctgggt
gtacgaccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatc
gttgtgtctggcttgactccaggagtggaatatgtctacaccatccaagtcctgagagac
ggacaggaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaaca
aacttgcatctggagacaaaccctgacactggagtgctcacagtctcctgggagaggagt
accaccccagacattactggttatagaattaccacaacccctacaaacggccagcaggga
tattctttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagt
cccggtctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccct
atctctgataccatcatcccagctgttcctcctcccactgacctgcgattcaccaacatt
ggtccagacaccatgcgtgtcacctgggctccacccccatccattgatttgaccaacttc
ctggtgcgttactcacctgtgaaaaatgaggaagatgttgcagagttgtcaatttctcct
tcagacaatgcagtggtcttaacaaatctcctgcctggtacagaatatgtagtgagtgtc
tccagtgtctacgaacaacacgagagcacacctcttagaggaagacagaaaacaggtctt
gattccccaactggcattgacttttctgatattaccgccaactcttttactgtgcactgg
attgctcctcgagccaccatcactggctacaggatccgccatcaccccgagcactatagc
gggagacctcgagaagatcgggtgcccccctctcggaattccatcaccctcaccaacctc
actccaggcacagagtatgtggtcagcatcgttgctcttaatggcagagaggaaagtccc
ttattgattggccaacaatcaacagtttctgatgttccgagggacctggaagttgttgct
gcgacccccaccagcttgctgatcagctgggatgctcctgctgtcaccgtgagatattac
aggatcacttacggagaaacaggaggaaatagccctgtccaggagttcactgtgcctggg
agcaagtctacagctaccatcagtggccttaaacctggagtcgattataccatcacagtg
tatgctgtcactggccgtggagacagccccgcaagcagcaagccgatttccattaattac
cgaacagaaattgacaaaccatcacagatgcaagtgaccgatgttcaggacaacagcatt
agtgtcaagtggctgccttcaagttcccctgttactggttacagagtaaccaccactccc
aaaaatggaccaggaccaacaaaaactaaaactgcaggtccagatcaaacagaaatgact
attgaaggcttgcagcccacagtggagtatgtggttagtgtctatgctcagaatccaagt
ggagagagtcagcctctggttcagactgcagtaaccaacattgatcgccctaaaggactg
gcattcactgatgtggatgtcgattccatcaaaattgcttgggaaagcccacaggggcaa
gtttccaggtacagggtgacctactcgagccctgaggatggaatccatgagctattccct
gcacctgatggtgaagaagacactgcagagctgcaaggcctcagaccgggttctgagtac
acagtcagtgtggttgccttgcacgatgatatggagagccagcccctgattggaacccag
tccacagctattcctgcaccaactgacctgaagttcactcaggtcacaccaacgagcctg
agcgcccagtggacaccacccaatgttcagctcactggatatcgagtgcgggtgaccccc
aaggagaagactggaccaatgaaagaaatcaaccttgctcctgacagctcatccgtggtt
gtatcaggacttatggtggccaccaaatatgaagtgagtgtctatgctcttaaggacact
ttgacaagcagaccagctcagggagttgtcaccactctagagaatgtcagcccaccaaga
agggctcgtgtgacagatgctactgagaccaccatcaccattagctggagaaccaagacc
gagacgatcactggcttccaagttgatgctgttccagccaatggccagactccaatccag
agaaccatcaagccagatgtcagaagctacaccatcacaggtttacaaccaggcactgac
tacaagatctacctgtacaccttgaacgacaatgcccggagctcccctgtggtcatcgac
gcctccactgccattgatgcaccatccaacctacgtttcctggccaccacacccaattcc
ttgctggtatcgtggcagccgccacgtgccaggatcaccggctacatcatcaagtatgag
aagcctgggtcttctcccagagaagtggtccctcggccccgccctggtgtcacagaggct
actattactggcctggaaccgggaactgaatatacaatttatgtcattgccctgaagaat
aaccagaagagcgagcccctgattggaaggaaaaagacagacgagcttccccaactggta
acccttccacaccccaatcttcatggaccagagatcttggatgttccttccacagttcaa
aagacccctttcatcacccaccctgggtatgacactggaaatggtattcagcttcctggc
acttctggtcagcaacccactgttgggcaacaaatgatctttgaggaacatggttttagg
cggaccacacctcccacaacagccacccccataaggcataggccaagaccatacccgccg
aatgtaggtgaggagattcaaattggtcacatccccagggaagacgtagactatcacctc
tacccacatgggctgggactcaatccaaatgcctctacaggacaagaagctctctctcag
acaaccatctcatgggccccattccaggacacttctgagtacatcatttcatgtcatcct
gttggcactgacgaagagcccttacagttcagggttcctggaacttccaccagtgctact
ctgacaggcctcaccagaggtgccacctacaacatcatagtggaggcactgaaagaccag
cagaggcataaggttcgggaagaggttgttaccgtgggcaactccgtcaatgaaggcttg
aaccaacctaccgatgactcatgctttgacccctacacggtttcccattacgccgttgga
gatgagtgggaacgaatgtctgaatcaggctttaaactgttgtgccactgcttaggcttt
ggaagtggtcatttcagatgtgattcatctagatggtgccatgacaatggtgtgaactac
aagattggagagaagtgggaccgtcagggagaaaatggccagatgatgagctgcacgtgt
cttgggaacggaaaaggagaattcaagtgtgaccctcatgaggcaacgtgttatgatgat
gggaagacgtatcacgtaggggaacagtggcagaaggaatatctcggtgccatttgctcc
tgcacatgctttggaggccagcggggctggcgctgtgacaactgccgcagacctgggggt
gaacccagtcccgaaggcactactggtcagtcctacaaccagtattctcagagataccat
cagagaacaaacactgtaagtgcattagcgccacgagtgtgtttcctcatactagacagt
cctttctacaggcatctttcttcagaatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670221
Entry
104670221         CDS       T03989                                 

Gene name
LAMA1
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104670221 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104670221 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670221 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670221 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104670221 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104670221 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104670221 (LAMA1)
   05414 Dilated cardiomyopathy
    104670221 (LAMA1)
   05416 Viral myocarditis
    104670221 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104670221 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104670221 (LAMA1)
   05145 Toxoplasmosis
    104670221 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF1080
Other DBs
NCBI-GeneID: 104670221
NCBI-ProteinID: XP_030782055
LinkDB
Position
21
AA seq 3580 aa
MAGSLLYGCQDTKENTYQARLLHTACDHTLNVAPQACSATNDQNLDCLHAGAGKQSGEQV
ATDFQNKSSSPLPTAERAAGRPSLGGVPRVRLSPSSRQGRVGPGPGTAGPRRGGQGQQGT
YFLGIHPPEPPQPSFSYPQPTFSAHLLSGAWAAAAVSRPPLPGVRVRGIPAAKQGAPGGG
VWAAGPGRAGRGAAGGCVRGRLEGGAAGTPGLRGRGSSDSRPAELFRRTRGFLPRPTERL
RGEMRGGGGAWGVLLASLLWVAARCQQRGEPGPGPWILGSLSPTGGRAGAAADKARRVGA
AGDRARILVHLGLGASDTPASPLAFAELSDPGAPSTRAVLGVAGAGRLGVLSVPRLRGQG
WRGCWPGAGNEWAKSSSESPSLSGCASWVAAVGEGRIPRGHSLPGGLVGRDAARSAPLAS
GPGQGDPQGGVQGTDAPSRPSLFVQSAKWPNPLIPRAGTWRGITLTPTEQSQNLGLGLSA
GWSRFFWKGQSSCKCGMKSHVACNVTVFQEPRKLLALEVPPELMDGLFPAILNLASNADI
STNATCGEKGPEMFCKLVEHVPGRPVRNPQCRICDGSSANPRERHPISHAIDGTNNWWQS
PSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVS
DSECLSRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKL
LEFTSARYIRLRLQRIRTLNADLMTLSHREPKDLDPIVTRRYYYSIKDISVGGMCICYGH
ASSCPWDETTKKLQCQCEHNTCGESCNRCCPGYHQRPWRPGTVSSGNTCEACNCHNKAKD
CYYDESVAKQKKSLNTAGQFRGGGVCTNCLQNTMGINCETCIDGYYRPHKVSPYEDEPCR
PCNCDPVGSLNSVCIKDDLHSDLRNGKGPGQCPCKEGYAGEKCDRCQLGYKDYPACVSCG
CNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFYNLKEKNPQGCSECFCFGVSDVCSSL
SWPVGQVSSMSGWLVTDLISPRRIPSQQDALGGRHQVSINNTAVMQTLAPKYYWAAPEAY
LGNKLTAFGGFLKYTVSYGIPVEAVDSNLMSHADVIIKGNRLTLSTQAEGVSLQPYEEYL
NVIRLVPENFRDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASP
NAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECRGHAAECDVHG
VCIACVHNTTGDHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVV
CDQCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCNSNVDPSEAGHCDSVTGECLKCLG
NTDGAHCERCAEGFYGDAVTAKNCRACGCHAKGSRSAVCHLETGLCNCKPNVTGQQCDQC
LHGYYGLDSGHGCQPCNCSVAGSVSDDCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSC
TPCDCPHTQNTCDPETGECVCPPHTQGVRCEECEDGHWGYDVEMGCQACNCSLVGSTHHQ
CDVVTGRCQCKWKFGGWACDECSLGYRDFPDCVPCDCDLRGTSGDACDLEQGLCGCAEET
GDCPCKENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHVCSELEGYVRTPVTLASD
QPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVWQHIHAEPFYWRLPQQFQGDQLMAYGG
KLKYSVAFYSLDGVGTSNFEPQVLIKGGRTRKQVIYMDAPAPENGVRQEQEVAMRENFWK
YFNSVSEKPVAREDFMSVLSNIEYILIKASYGQGLQQSRISDISMEVGRKAENLHPEEEV
ASLLENCVCPPGTVGFSCQDCAPGYHRGKLPAGSGRGPRPLVAPCVPCSCNNHSDTCDPN
TGKCLNCGDNTAGDHCDVCASGYYGKVTGSASDCALCVCPHSPPASFSPTCVLEGDHDFR
CDACLLGYEGQHCERCSLGYYGNPQTLGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGAS
GLRCDECEPRHILMETDCVSCDDECVGVLLNDLDETGDAILSLNLTGIIPVPYGILSKLE
NTTKYLQESLLRENMQKDLGRIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQ
DLAVAIERLRMNITEIIEKTTLNQTLDEDFLLPNSTLQSMQQNGTSLLEIMQRRDVTQLH
QNATLELKAAEDLLSQIQENYQKPLEELEVLKEAASHLLSKHNSELKAAEVLVREAEAKT
EESNHLLFMVNANLREFSDKKLHVQEEQNLTSELIAQGRGLIDTAAAQTDAVQDALEHLE
HHQDTLLLWSAKVRHHVDDLVMHMSQRNALDLVYRAEDHAAEFQRLADVLDSGLENVRNV
SLNATSAAYVHYNIQNLIEESEELAKDAHRTVTEMSLLSESLVSNGKAAVQRSSRFLNEG
NNLSRKLPVIALELSELRNKTNRFQENADEITRQTNESVLILRAIPEDTRDKGAKTKELA
TSASQSAVSTLRDVAGLSQELLSTSASLSRVNTTLQETHQLLQDSTMATLLAGRKVKDVE
TQANLLFDRLKPLKMLEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQIS
STNYNTLTLNVKTQEPDNLLFYLGSSTSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFP
IDDNRWHSIHAARFGNIGSLSVKEMNSNQKLPAKTSKSPGTANVLDVNNSTLMFVGGLGG
QIKKSPAVKVTHFKGCLGEAFLNGKSIGLWNYIEREGKCHGCFGSSQNEDPSFHFDGSGY
SVVEKSLPATVTQIIMLFNTFSPNGLLLYLGSYGIRDFLSIELFHGRVKVTTDLGSGPLT
LLTDRRYNNGTWYKIAFQRNRKQGVLAVNDAFNTSNKETKQGETPGASSDLNRLDKDPIH
VGGLPRSRVVRRGVTTKSFVGCIKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGG
YIELPPKSLSPESEWLVTFATKNSSGIILAALGGDAEKQGDREESHVPFFSIMLIGGNIE
VHVNPGDGTGLRKALLHAPTGTCSDGQAHSISLVRNRRIITVQLDENNPVEMKLGPLVES
RTINMSNLYVGGIPEGEGTSLLTTRRSFHGCIKDLIFNLGLLDFNSAVGHEQVELDACWL
SERPKPAPDAEDSELLPDPRAFPEQCVVDAALEYVPGAHQFGLSQNSHFLLPFNQSAVRK
RLSVELSIRTFASSGLIYYMAHQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDG
KWHTVKTHYGKRKGFITVDGQESPMVTVVGDGTALDVEGLFYLGGLPSQYRARKIGNITH
SIPACIGDVTVNSKQLDKDSPVSTFTVNRCYAAAQEGTFFDGSGYAALVKEGYKVQTDVN
ITLEFRTSSQNGVLLGISTAKVDAIGLELVDGKVLFHVNNGAGRITATYEPKTATALCDG
KWHTLQANKSKHRITLIVDGNAVGAESPHTRSTSVDTNNPIYVGGYPAGVKQKCLSSQTS
FHGCLRKLALMKRPQVQSFDFSRAFELHGVFLHSCPGTES
NT seq 10743 nt   +upstreamnt  +downstreamnt
atggctggatccctgttatatgggtgtcaggatacaaaggaaaacacttaccaggccagg
cttcttcatacagcctgtgatcacacactgaatgtggctccccaagcctgctcagccacc
aatgaccagaacctggattgtctacatgcaggagcaggcaaacaaagtggggaacaagtt
gcaactgattttcagaacaaatcctcaagtcctctgcccacggcggagagggcagcgggt
cggccgagcctgggtggcgtcccgagggttcgcctctcgcccagctcccggcaggggcgc
gtgggtcctggcccggggactgcagggccgcggcggggcgggcagggtcagcagggcaca
tactttctcggaatccaccctcccgagcccccacagcccagtttctcctaccctcagccc
accttctccgcccacctcctatccggagcctgggcggcggccgcggtcagcagacctccc
ctaccaggggtccgcgtgcgcgggatcccggcggccaagcagggcgccccgggaggaggg
gtctgggcggctgggccaggccgggcggggcggggcgcagccggggggtgtgtccgaggg
cggctggagggaggggctgccgggacaccagggctgcggggccgcggcagctcagactcg
cgtcccgcggagcttttcaggcggacgcgcggctttctccccagacccaccgagcggcta
agaggcgagatgcgcggcggcggcggcgcgtggggcgtgctcctggcctcgctgctgtgg
gtagccgcgcggtgccagcagagaggtgagcccggcccgggtccctggatcctcgggtcc
ctgtcccccacaggcgggcgggcgggggcggccgcggacaaagcccgtcgcgtgggggct
gctggagaccgggcgcgcatcctggtccacctcggactgggggcttctgacactccagcc
tcgcctctggcttttgcggaacttagtgacccaggagcgccatctacgcgagcagtcctg
ggggtggcgggagcggggcgcctgggggtgctttcagtgccccggctgcgcgggcagggg
tggcggggctgctggccgggcgcggggaatgaatgggcaaagagctcctccgaatcaccc
tcattgtccggctgcgcaagctgggtcgccgcggtcggggaagggcggattcctcggggc
cactcgctgccgggcgggctagtggggagagacgcggcgagaagcgcgcccctcgccagc
ggccccgggcagggggacccgcagggcggcgttcagggcactgatgcgccttcccgaccc
tcgctctttgtgcaatcggctaagtggccaaacccgctcattccccgcgcaggcacttgg
agaggtatcacactgacgccaactgagcagagccagaacctgggcctggggctgtctgca
gggtggagcaggttcttctggaagggccagtccagctgcaagtgtgggatgaagtctcat
gtagcctgtaatgtaacagttttccaagagcccagaaagctgttggcattggaagttccc
cctgagttaatggacggcctgtttcctgccattctcaatcttgccagcaacgctgacatc
agtaccaatgccacctgtggcgagaaggggcccgagatgttctgcaaacttgtggagcat
gtgccgggtcggcccgtccgaaacccacagtgccggatctgtgatggcagcagtgcaaac
cccagagaacgccatccaatatcacatgccatagatggcaccaataactggtggcaaagt
cccagcattcagaatgggagagagtatcactgggtcacaatcactctggacttaaggcag
gtctttcaagttgcatatgtcatcattaaagctgccaatgcccctcggcccggaaactgg
attttggagcgttctctagatggcaccacgttcagcccctggcagtattatgcagtcagc
gactcagagtgtttgtctcgttacaatataactccaagacgagggccgcccacctacagg
gctgatgatgaagtgatctgcacctcctattattccagattggtgccacttgagcatgga
gagattcatacatcactcatcaatggcagaccaagcgctgacgatctttcacccaagttg
ttggaattcacttctgcacgatatattcgccttcgcttacaacgcattagaacgctcaat
gcagatctcatgactcttagccaccgggaacctaaagacctggatcctattgttaccaga
cgctattattattcaataaaggacatttctgttggaggcatgtgtatctgctatggccat
gctagtagctgtccatgggatgaaactacaaagaaactgcagtgtcagtgtgagcataat
acttgcggggagagctgtaacaggtgctgtcctgggtaccatcagcggccctggaggcct
ggaaccgtgtcctctggcaatacatgtgaagcatgtaattgtcacaataaagccaaagac
tgttactatgatgaaagtgttgcgaagcagaagaaaagtttgaatactgctggacagttc
agaggaggaggggtttgcacaaactgcttgcagaacaccatgggaattaactgtgagacc
tgtattgatggatattacagaccacacaaagtgtctccttatgaggatgagccttgccgc
ccctgcaactgtgaccctgtggggtccctcaattctgtctgtattaaggatgaccttcat
tctgacttacgcaatgggaaggggccgggtcagtgcccgtgtaaggaaggctatgcagga
gaaaaatgtgatcgctgccaacttggctataaggattacccggcctgtgtctcctgtggg
tgcaacccagtgggcagtgccagtgacgagccctgcacagggccctgtgtttgtaaggaa
aatgtggaggggaaagcctgcgatcgctgcaagccaggattctataacctgaaagaaaaa
aacccccagggctgctccgagtgcttctgctttggcgtttccgatgtctgcagcagcctc
tcttggcctgttggtcaggtaagcagtatgtccgggtggctggtcaccgacctgatcagt
cccaggaggattccgtctcagcaagatgcactgggcgggcgccaccaggtcagcatcaac
aacaccgcggtcatgcagacgctggctcccaagtactactgggcggcccccgaggcctac
cttggaaataagctgactgcatttggtggattcctgaaatacacagtgtcttatggcatc
ccagtagaggcggtagacagtaacctcatgtcgcacgctgacgtcatcattaagggaaac
agactcactttaagcacacaggctgagggtgtgtcattgcagccttatgaagagtaccta
aatgtgattagacttgtgcctgaaaacttccgagattttcacagcaaaaggcagatcgat
cgtgaccagctgatgactgtccttgccaatgtgacacatcttttgatcagagccaactac
aattctgcaaaaatggctctttacaggttggagtccgtctctctggacatagccagccct
aatgccatcgacctggtggtggccgctgatgtggagcactgtgaatgtccgcaaggctac
acagggacctcctgtgagtcgtgcctctctggctattaccgcgtggatggaatactattc
ggaggaatttgtcagccctgcgaatgccgcggccatgcagctgagtgcgatgttcacggc
gtttgcattgcatgtgtgcacaacaccaccggtgaccactgtgaacagtgcttacctggc
ttctacggggagccttcccgagggactcccggggactgccagccctgcgcctgccctctc
accatagcctccaacaatttcagccccacctgccacctcaatgatggggatgaggtggtc
tgcgaccagtgtgccccaggatactcaggagcttggtgtgagagatgtgcagatggttac
tatggaaacccaacagtgcctggcgaatcttgtgttccctgtgactgcaacagcaatgtg
gacccctcggaggctggtcactgtgactcggtcaccggggagtgcctgaagtgcctgggg
aacacagacggcgcccactgtgaaaggtgtgctgaaggtttctacggggacgctgtgaca
gccaagaactgccgcgcctgcggatgccatgcgaaaggctcccgttctgccgtgtgccat
cttgagaccggactctgcaactgcaaaccaaacgtgactggacagcagtgtgaccagtgt
ttgcatggctattatgggctagactcgggccatggctgccagccctgcaattgcagcgtg
gcaggctccgtgtcagatgactgcacagatgaaggccagtgtcactgcgtcccgggtgtg
gcagggaaaaggtgtgacaggtgtgcccatggcttctatgcctaccaggatggcagctgt
acaccctgtgactgcccacacactcagaatacctgcgacccagaaactggagagtgtgtc
tgcccccctcacacacagggtgtgaggtgtgaagaatgtgaggatgggcactggggctac
gatgtggagatggggtgccaggcctgcaactgcagtctcgtggggtcgactcatcatcag
tgtgacgtggtcaccggccgttgccagtgcaagtggaaatttggtggctgggcctgtgat
gagtgctccttgggttacagagactttcccgactgtgttccctgtgactgtgacctgagg
gggacatcgggggatgcctgcgacctggagcagggtctctgcggctgtgcagaggaaacc
ggggactgcccttgcaaggagaatgtctttggccctcagtgcaacgagtgtcgagagggc
acctttgccctccgcgcggacaaccccctgggctgcagcccctgcttctgctctgggctg
tcccacgtctgctcagagctggagggctacgtgaggaccccagtaacgctggcctccgat
cagcctcttctgcgtgtggtttctcagagtaacctgaggggcacgactgagggggtttac
taccaggcccccgacttcctactggatgccgccaccgtctggcagcacatccatgcagag
ccgttttactggcggctgccgcagcagttccagggagaccagctcatggcctatggtggc
aaactgaagtacagcgtggccttctattctttggacggcgtcggcacctccaattttgag
cctcaagttctcatcaaaggtggtcggaccagaaagcaagtcatttacatggatgcacca
gccccagagaatggagtgaggcaggaacaagaagtagcaatgagagagaatttttggaaa
tattttaactctgtttcggaaaaacctgtcgcgcgagaggattttatgtctgtccttagc
aatattgagtacatcctcatcaaggcatcatatggtcaaggattacagcagagcagaatc
tcagacatttcaatggaggttggcagaaaggccgaaaacctgcacccagaagaagaggtt
gcatctcttttagagaattgtgtctgtcctcctggcactgtgggattctcatgtcaggac
tgtgctcctgggtaccacagagggaagctcccagcagggagtggcaggggaccgcgccct
ctggttgctccttgtgtgccctgcagctgcaacaaccatagtgacacctgtgaccccaac
accgggaagtgtctgaactgcggcgataacacagcaggtgaccattgcgatgtgtgtgct
tctggctactatgggaaggtgactggctcagcaagtgactgtgctctgtgtgtctgtcct
cacagcccccctgccagttttagtcccacttgtgtcttggaaggtgaccacgatttccgt
tgtgatgcctgtctcctgggctatgaaggacaacattgtgaaaggtgctccttgggctat
tatgggaaccctcaaacactaggtggcagttgccagaagtgtgactgcaaccctcacggc
tctgtccatggcgactgtgaccgcacatctgggcagtgtgtttgcaggctgggggcctcg
gggctccggtgcgatgagtgtgaaccgaggcacattctgatggaaacagattgtgtttcc
tgtgatgatgaatgtgtaggtgtgctgctgaatgacttggatgagactggtgatgccatt
ctttctctgaacctcactggcattatccctgtcccatatggaattttgtcaaagctggaa
aatacaactaaatatctccaggaatctttattaagagaaaatatgcaaaaggacctggga
agaattaagcttgaaggtgttgcagaagaaacggataacctgcaaaagaagctcactaga
atgttagcaagtacccaaaaggtgaatagggcaactgagagaatcttcaaggagagtcaa
gacctggccgtagccattgagaggttgcggatgaacatcacagaaattattgaaaagaca
actttaaatcagactttggatgaagatttcctgctacccaattctacgcttcagagcatg
caacaaaatgggacatctttgctggaaatcatgcagagaagagacgtcacacagttgcac
caaaatgccacccttgaactcaaggctgctgaagatttattgtcacaaattcaggaaaat
taccaaaagccgctggaagaattggaggtattgaaagaagcagcaagccacctcctttca
aagcacaacagtgaactaaaggcagctgaggtgcttgtgagggaagccgaggcaaagacc
gaggaaagcaaccacctgctgttcatggtcaatgctaacctgagagaattcagtgataaa
aagctacatgttcaagaagaacaaaatctgacctcagagctcattgcccaaggaagagga
ctgatagatactgctgctgcacaaacagacgctgtacaagatgctctagagcacttagag
catcaccaggatacgctacttttatggtctgccaaagtcaggcaccacgtagatgacctg
gtcatgcacatgtcccaaaggaacgcacttgacctggtctacagagctgaggaccatgcc
gctgagttccagagactagcagatgttctggacagtggccttgaaaatgtcagaaatgtg
tccctgaatgccaccagtgcagcctatgtccattacaacatccagaacctgatcgaagaa
tcggaggaactggccaaagatgctcacaggactgtgactgagatgagcctgctctcagaa
tcccttgtttctaatgggaaagcggccgtgcagcgcagctccagatttctaaatgaaggc
aacaacctcagcaggaagcttccagttattgcattggaactgagtgagctgagaaataag
acaaacagatttcaagagaatgccgatgaaattacccggcagaccaatgaatcagtcttg
atactcagagcaattcctgaagatacaagagacaaaggagccaaaaccaaagagctagcg
acgtctgcaagccagagcgcggtgagcacgctgagggacgtggcagggctgagccaggag
ctgctgagcacatctgccagcctgtccagggtcaacaccacattacaagagacgcaccag
cttctgcaggactccaccatggccactctgttggctggaagaaaagtcaaagacgtggaa
actcaagccaaccttttgtttgatcggttgaagcctttgaagatgttagaagagaatctg
agcagaaacctatcagaaattaaactgctcatcagccaggcccggaaacaagcggcttct
attaaagtcgctgtgtctgcagacagagattgcatccgggcctaccagcctcagatttcc
tctactaactacaacaccttaacactaaatgttaagacacaggaacccgataatcttctc
ttctacctcggtagcagcacctcttctgatttccttgcagtggagatgcggcgagggaaa
gtggccttcctgtgggacctgggctccgggtccacacgcttggagtttccagactttccc
attgatgacaacagatggcacagtatccatgccgccagatttggaaacattggttcactg
agtgtaaaggaaatgaactcaaatcaaaagctaccagcaaaaacaagtaaatcccctggg
acagctaatgttctggatgtaaacaattcaacactcatgtttgttggaggtcttggagga
caaatcaagaaatctcctgctgtgaaggttactcattttaaaggctgcttgggagaagcc
ttcctgaatggaaaatccattggcctatggaactatattgaaagggaaggcaagtgtcat
gggtgcttcggaagctcccagaatgaagacccttccttccattttgacgggagtgggtac
tctgtcgtggagaagtcacttccggctaccgtgactcagataatcatgctttttaatacc
ttttcacctaatggacttcttctctacctgggttcatacggcataagagactttttatcc
atcgagctgttccatggcagagtgaaggttacgactgacctgggttcaggaccacttacc
cttttgacagatagacgttataacaatggaacctggtacaaaattgccttccagcgaaac
cggaagcaaggagtcctagcagttaacgatgcctttaacaccagtaataaagaaaccaag
cagggcgagactccgggagcatcttccgacctcaaccgtctagacaaggatccgattcat
gtgggtggattgccaaggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtg
ggctgcatcaagaacctggaaatatccagatcaacctttgacttactcagaaattcctac
ggagtgagaaaaggctgcttactggagcccatccggagcgttagcttcttgaaaggcggc
tacattgaattgccacccaagtctttgtcaccagaatcggaatggctggtaacatttgcc
accaagaacagcagtggcatcatcctggctgccctcggtggggatgcagagaagcagggt
gatcgtgaggagtcacacgtgcccttcttttccatcatgctgattggaggcaacattgag
gtacatgtcaatcctggggatggcacaggcctgaggaaagctctcctgcacgctcccacg
ggtacatgcagcgatggacaagcacattccatctccttggtcaggaatcggagaattatc
actgtccagttggatgagaacaatcctgtggaaatgaagttgggcccattagtagaaagc
aggacgataaatatgtccaatctgtacgtcgggggaattccagagggagaggggacatca
ctgcttacaacgagaagatcgttccatggttgtatcaaagacctgatctttaatttggga
cttttggatttcaacagtgcagttggccatgagcaagttgaattggacgcctgctggctg
tcagaaaggcctaagccggctcccgatgcagaggacagcgagctcttgccagacccccgg
gcttttccagaacagtgtgtggtggatgcagctctggagtacgttcctggcgcccaccag
tttggtctctcacaaaacagccattttctgttgccttttaatcagtcggctgtcagaaag
aggctctcggttgagctaagtatccgcacgttcgcctccagcggcctgatttactacatg
gctcatcagaaccaagcagactacgctgtgctccagctgcacgggggccgcctccacttc
atgtttgaccttggcaaaggcagaacaaaggtctctcaccctgcactgctcagcgatggc
aagtggcacacggtcaagacacattatggtaaaagaaaaggcttcatcacggtggacggc
caagagtcccccatggtgactgtggtgggagacggaaccgcgctggatgtggagggcttg
ttctacctaggaggcctgccctcccagtaccgggccaggaaaattggaaatatcacccac
agcatccctgcctgcattggggatgtgacggttaacagcaaacagctggacaaggacagc
ccagtgtccaccttcacagtgaacaggtgctacgcagcggcccaggaaggaacattcttt
gatggaagcggatacgcagctcttgtcaaagagggctacaaagtccagacggatgtgaac
atcacactggaatttcgaacctcctcgcagaatggcgtcctcctggggatcagcactgcc
aaagtggatgccattggactagagcttgtggatggcaaggtcttgttccatgtcaacaat
ggtgctggcaggataacagccacatatgagcccaaaaccgccactgcgctctgtgatgga
aaatggcacacgcttcaagctaacaaaagcaaacaccgtatcactctgattgtcgatggg
aacgcagttggcgctgaaagtccacacacccgctctacctcggtggacaccaacaatccc
atttatgttggtggctatcctgctggcgtgaagcaaaaatgcctgagcagccagacctcg
ttccacgggtgtttgaggaagctagcgctgatgaagaggccgcaggtgcaatcctttgac
ttcagcagagcgtttgaactgcacggagttttccttcattcctgtcctgggacggagtcc
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671965
Entry
104671965         CDS       T03989                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04974  Protein digestion and absorption
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104671965 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104671965 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104671965 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104671965 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    104671965 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671965 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104671965 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104671965 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104671965 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104671965 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104671965 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104671965 (COL4A3)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104671965 (COL4A3)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104671965 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 104671965
NCBI-ProteinID: XP_010373925
UniProt: A0A2K6NDV2
LinkDB
Position
14
AA seq 1670 aa
MSPRTAPRSQVLLLQLLLVLLAAPPTASKGCVCKDKGQCFCDKAKGEKGERGFPGPPGSP
GQKGFTGPEGLLGPQGPKGSSGLPGLTGPKGVRGVTGLPGFSGSPGLPGTPGNTGPYGLV
GVPGCNGSKGEQGFPGLPGTLGYRGIPGAPGLKGQKGAPAKGEDIELDAKGDPGLPGAPG
PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGQKGERGVKGLTGPPGP
PGTVIVTLTGPDNRTDLKGEKGDKGAIGQPGPPGPSGLPGESYGSEKGAPGDPGPQGKPG
KDGVPGFPGSEGVKGNRGFPGLAGEDGIKGQKGDTGPPGFRGPTEYYDTYQEKGDEGIPG
PPGPKGGRGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGYPGKEAMGTPGSP
GCPGSPGPPGSPGPPGPPGDIIFRKGPPGDRGLPGYLGSSGIPGIDGPKGEPGLLCTQCP
YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGIPGFPGAEGDRGLKGEK
GETLQPEGQVGAPGDPGLRGQPGRKGFDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD
PGSPGSPGPAGPAGPPGYGPQGEPGPQGMQGVPGAPGPPGEAGPRGELSVSTPVPGPPGP
PGPPGHPGPQGPPGMPGSMGKCGDPGLPGPDGEPGIPGIGFPGRPGPKGDQGFPGTKGSL
GCPGKIGEPGLPGKPGVPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG
TPGNEGFDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKMGPKGD
PGIPGLDRSGFPGETGSPGMSGHQGEMGPPGQKGYPGNPGLLGPPGEDGVVGMMGFPGAT
GPPGPPGNPGMPGQRGSLGIPGVKGQRGTPGAKGEQGDKGNPGPSQISHVIGDKGEPGLK
GFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSIGNPGEPGLRGIPGSMGNM
GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGEMG
KKGEMGQPGPPGHSGPAGPEGAHGSPGSPGLPGKPGPHGDLGFKGIKGFPGPPGIKGPSG
LPGFPGSPGPMGVRGDQGRDGIPGPAGEKGEMGLSGAPPGPRGNPGAQGAKGDRGSPGFP
GLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQKGNHGPPGLRGSPGEPGPPGPPG
SHVIGIKGDKGSMGHPGPKGPPGTVGDMGPPGHLGAPGTPGLPGLRGDPGFQGFPGVKGE
KGNPGFLGSIGPPGPIGPIGPPGIRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP
PGNLGPCGPRGKPGKDGKPGSPGPAGEKGNKGSKGEPGPPGSDGLPGLKGKRGDSGSPAT
WTTRGFVFTRHSQTTAIPSCPEGTAPLYSGFSFLFVQGNERAHGQDLGTLGSCLQRFTTM
PFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIVIAV
HSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG
TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
NT seq 5013 nt   +upstreamnt  +downstreamnt
atgagcccccggacggcgcccagatcgcaggtgctcctgctgcagctcctgctggtgctc
ctggccgcgccgcccacggccagcaagggctgtgtctgtaaagacaaaggccagtgcttc
tgtgacaaggccaaaggggagaagggggagagaggctttcctggaccccctggttctcct
ggccagaaaggattcacaggtcctgaaggcttgcttggaccacagggacccaagggctct
tcaggacttccaggactcacgggtcccaaaggtgtaaggggagtaactggattgccagga
ttttctggttctcctggacttccaggcaccccaggcaatactgggccttatggacttgtc
ggtgtaccaggatgcaatggttctaagggtgagcaggggtttccaggactcccagggaca
ctgggctaccgagggatcccgggtgctcctggtttgaaaggacaaaagggtgctcctgct
aaaggagaagatatagaacttgatgcaaaaggcgaccccgggttgccaggggctccagga
ccccagggtttgccaggccctccaggttttcctgggcctgttggcccacctggtcctccg
ggattctttggctttccaggagccatgggacctagaggacctaagggtcacatgggtgaa
agagtgataggacaaaaaggagagcggggtgtgaaagggttaacaggacccccgggacca
ccaggaacagttattgtgaccctaactggcccagataacagaacggacctcaagggggaa
aagggagacaagggagccatcggccagcctggacctcctggaccctcaggactgcctgga
gaatcatacggatctgaaaagggtgctcctggagaccccggcccgcagggaaaacccggt
aaagacggcgttcctggcttccctggaagtgagggagtcaagggcaacaggggtttccct
gggttagcaggtgaagatggcattaagggacagaaaggggacactggccctccaggattt
cgtggtccaacagaatattatgacacataccaggaaaagggagatgaaggcattccaggc
ccaccagggcccaaaggaggtcgtggcccacaaggtcccagtggtccccccggagttcct
ggaagtcctggatcctcaaggcctggcctcagaggagcccctggatggccaggcttgaaa
ggaagtaaaggggaacgaggctacccaggaaaggaagccatggggactcctgggtcccca
ggttgtcctggttcaccaggccctccaggatcaccgggacctccaggaccaccaggtgac
atcatttttcgcaagggtccacctggagatcgcggactgccaggctatctagggtcttca
ggaatcccaggcattgatgggcccaaaggagaaccaggcctgctgtgtacacagtgccct
tatatcccagggccccccggtctcccaggattgccagggttacatggtgtaaaaggaatc
ccaggaagacaaggtgcagctggcttgaaaggaagcccagggtccccaggaaatacagga
cttccaggaattccaggtttcccaggtgccgagggtgaccgaggacttaaaggagaaaaa
ggtgaaacacttcagcctgaggggcaagttggtgccccaggggacccggggctcagaggt
caacctgggagaaagggcttcgatggaattcctggaactccgggagtgaaaggattacca
ggacctaaaggcgaactggctctgagtggtgagaagggggaccaaggtcctccaggggat
cctggctcccctgggtccccaggacctgcaggaccagctggaccacctggctacggaccc
caaggagaacctggtccccagggcatgcaaggagttcctggagcccctggaccacccgga
gaagccggtcctaggggagaactcagtgtttcaacaccagttccaggcccaccaggacct
ccagggccccctggccatcctggcccccaaggtccacctggtatgcctggatctatgggg
aaatgtggagatcctggtcttccaggacctgatggtgaaccaggaattccgggaattgga
tttcctgggcgtcctggacctaagggagaccaaggttttccgggtacaaaaggatcactg
ggttgtcctggaaaaataggagagcctgggttacctggaaagccaggcgtcccaggagcc
aagggagaaccagcagtagccatgcctggaggaccaggaacaccaggttttccaggagaa
agaggcaattctggagaacatggagaaattggactccctggacttccgggtctccctgga
actccaggaaatgaagggtttgatggaccacgaggagatccagggcagcctggaccacct
ggagaacaaggacccccaggaaggtgcatagagggtcctaggggagcccaaggacttcca
ggcttaaatggattgaaagggcaacaaggcagaagaggtaaaatggggccaaagggagac
ccaggaattccaggcttggatagatcaggatttcctggagaaactggatcaccaggaatg
tcaggtcatcaaggcgagatgggaccaccaggtcaaaaaggatatccaggaaatccagga
cttttagggccaccaggtgaagatggagtggttgggatgatgggctttcctggagccact
ggccctccggggccccctgggaacccaggcatgccagggcagagggggagccttggaatt
ccaggagtaaagggccagagaggaaccccaggagccaagggggaacaaggagataaagga
aaccccgggccttctcagatatcccacgtaataggggacaaaggagaaccaggtctcaaa
ggattcgcaggaaatccaggtgagaaaggaaacagaggtgttccagggatgccaggttta
aaaggcctcaaaggactacctggaccagcaggaccaccaggccccagaggagatttgggc
agcattgggaatcctggagaaccaggactacgtggtataccaggaagcatggggaacatg
ggcatgccaggttctaaaggaaaaaggggaactttgggattcccaggtcgagcaggaaga
ccaggcctcccaggtattcacggtctccagggagataaaggagagccaggttattcagaa
ggtacaaggccaggaccaccgggaccaacgggggatccaggactgccgggtgaaatggga
aagaaaggagaaatggggcaacctggcccacctggacattcggggcctgctggacctgag
ggagcccatggaagtcctggaagtcctggcctcccaggaaagccaggtcctcatggtgat
ttgggttttaaaggaatcaaaggcttcccgggccctccaggaatcaaaggcccttcaggt
cttccaggattcccagggtctcctggaccaatgggtgtaagaggtgaccaaggacgtgat
ggaattcctggtccagccggagaaaagggagaaatgggtttatcgggggcccctccaggc
ccaagagggaacccgggtgctcaaggagctaaaggagacaggggatccccaggttttcct
ggcctccctggcagaaaaggggccatgggagatgctgggcctcgagggcccacaggcata
gaaggattcccagggccaccaggtctgcccggtgcaattatccctggccagaaaggaaat
catggtccaccaggcttaagaggaagcccaggtgagcctggtccccctggacctccaggg
agtcacgtaataggcataaaaggagacaaagggtctatgggccaccctggcccaaaaggt
ccacctggaactgtaggagacatgggaccaccaggtcatctgggagcaccaggtactcca
ggtcttccaggactcagaggtgatcctggattccaggggtttccgggcgtgaaaggagaa
aagggtaatcctggatttctaggatccattggacctccaggaccaattgggccaatagga
ccacctggtatacgtggagaccctggcacacttaagattatctcccttccaggaagccca
gggccacctggcacacctggagaaccagggatgcagggcgaacctgggccaccagggcca
cctggaaacctaggaccctgtgggccaagaggtaagccaggcaaggatggaaaaccagga
agtcctggaccagctggagaaaaaggcaacaaaggttctaaaggagagccaggaccacct
ggatcagatggattgccaggtttgaaaggaaaacgtggagacagtggatcacctgcaacc
tggacaacgagaggctttgtcttcacccgacacagtcaaaccacagcaatcccttcatgt
ccagaggggacagcgccactctacagtgggttttcttttctttttgtacaagggaatgaa
cgagcccacggacaagacctcggaactctgggcagctgcctgcagcgatttaccacaatg
ccgttcttattctgcaatgtcaatgatgtatgtaatttcgcatctcgaaatgattattca
tactggctgtcaacaccagctctgatgccaatgaacatggctcccattactggcagggcc
cttgagccttatataagcagatgcactgtttgtgaaggtcctgcgatcgtcatagccgtt
cacagccaaaccactgacattcctccatgtcctcatggctggatttctctctggaaagga
ttttcattcatcatgttcacaagtgcaggttctgagggcaccgggcaagcactggcctcc
cccggctcctgcctggaagaattccgagccagcccatttctagaatgtcatggaagagga
acgtgcaactactattcaaattcctacagtttctggctggcttcattaaacccagaaaga
atgttcagaaagcctattccatcaactgtgaaagctggagaattagaaaaaataataagt
cgctgtcaggtgtgcatgaagaaacgacactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671966
Entry
104671966         CDS       T03989                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04974  Protein digestion and absorption
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104671966 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104671966 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104671966 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104671966 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    104671966 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671966 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104671966 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104671966 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104671966 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104671966 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104671966 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104671966 (COL4A4)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104671966 (COL4A4)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104671966 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 104671966
NCBI-ProteinID: XP_010373928
UniProt: A0A2K6PCA1
LinkDB
Position
14
AA seq 1690 aa
MSSLHVVLMRCSFRLTKSLATGPWSLILILFSVQYVYGSGKKYVGPCGGRDCSVCHCVPE
KGSRGPPGPPGPQGPIGPLGAPGPTGLSGEKGMRGDRGPPGTAGDKGDKGPTGVPGFPGL
DGIPGHPGPPGPRGKPGKCGYNGSRGDPGFPGGRGALGPGGPPGHPGEKGEKGNSVFILG
AIKGIQGDRGDPGLPGLPGSWGAGGPAGPTGYPGEPGLVGPPGQPGLPGLKGNPGVGVKG
QMGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMIGLPGPPGRKGESGIGAKGE
KGIPGFPGPWGDPGSYGSPGFPGLKGEVGLVGDPGLFGFLGPKGDPGDRGHPGPPGVLVT
PPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPG
EAGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSATYCSVGNPGPQGIKGKVGPPGGR
GSKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGL
PGKPGASGPPGNKGAKGDVVISRVKGHKGERGPDGPPGFPGQPGSHGLDGHAGEKGDPGL
PGDHEDAIPGDKGFPGPLGPPGKAGPVGPPGLGFPGPPGERGHPGVPGCPGVRGPGGLKG
QKGDTISCNVTYPGRQGPPGFDGPPGPKGFPGPQGAPGLSGSDGHKGRPGTPGTSEIPGP
PGFRGDIGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGPPGRRGLSGVPG
IKGPRGDPGYPGAEGPAGIPGFPGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPG
LPGDPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPG
PPGPKGPRGLPGFPGFPGERGKPGAEGCPGTKGEPGEKGTSGFPGDQGVRGAKGAIGPPG
DEGEMAIISKKGKPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGEPGEK
GQPGPPGHPGPPGSTGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGATGPKGNKGDPASH
FGPPGPKGEPGSSGCPGHFGASGDRGLPGVQGPRGSPGRPGPPGSSGPPGCPGDQGMPGL
RGQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPP
GPVGMPGLKGERGDPGSPGISPPGPCGEKGLPGPPGRSGPPGPAGATGRAPKDIPDPGPS
GDQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGLPGPPGPPGYKGFPGCDGK
DGQKGPMGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGPRGEPGPLADANDCPRIPG
LPGVPGLRGPEGAMGLPGMRGPPGPGCKGEPGLDGRRGMDGIPGSPGPPGRKGDTGEDGY
PGGPGPPGPTGDPGPKGFGAGYLSGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQE
KAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIR
PYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPG
SCLEDFRAAPFLECQGRQGTCHFFANEYSFWLTTVKADLQFSPAPAPDTLKESQAQRQKI
SRCQVCVKYS
NT seq 5073 nt   +upstreamnt  +downstreamnt
atgtcgtctctgcatgtagtactaatgaggtgctccttcagattgaccaagtcattggcc
acaggtccatggtcacttatactcattctcttttctgtacaatatgtatatgggagtgga
aagaaatacgttggtccttgtggaggaagagattgctctgtttgccactgcgttcctgaa
aaggggtctcggggtccaccaggaccaccagggccacagggtccaattgggcccctggga
gccccaggacccactgggctttcaggagagaaaggaatgagaggggaccgcggccctcct
ggaacagcaggggacaaaggagataagggtccaactggtgttcctggatttccaggttta
gatggcatacctgggcacccagggcctcctggacccagaggcaaacctggtaagtgtggc
tacaatggctcaagaggtgacccagggtttccaggaggaagaggagctcttggtccagga
ggccccccaggccatcctggggaaaagggagaaaaaggaaattcagtgttcattttaggt
gccattaaaggtattcagggagacagaggcgacccaggactgcctggcttaccaggatct
tggggtgcaggaggaccggcaggccccacaggatatcctggagagccagggttagtggga
cctccgggccaaccagggcttccaggtttgaagggaaatcccggtgtgggagtaaagggg
caaatgggagacccgggtgaggttggtcagcaaggttctcctggacccaccctgttggta
gagccacctgacttttgtctctataaaggagaaaagggcataaaaggaattcctggaatg
attggactgccaggaccaccaggacgcaagggagaatctggtatcggggcaaaaggagaa
aaaggcatccctggatttccagggccttggggggatcctggttcctatggatctccaggt
ttcccaggattaaagggagaagtaggactggttggagatcctggtctatttggatttctt
ggcccaaagggggatcctggagaccgagggcacccaggaccaccaggtgttttggtgact
ccacctcttccactcaaaggcccaccaggggacccaggattccctggccgctatggagaa
acaggggatgttggaccacctggtcccccaggtctcttgggcagaccaggggaagcctgt
gcaggcatgataggtccccctgggccacaaggatttcctggtcttcctgggcttccagga
gaagctggtattcctgggagacctgattctgctccaggaaaaccagggaagccaggatca
cctggcttgcctggagcaccaggcctgcagggcctcccaggatcaagtgcgacatactgt
agtgttgggaaccctggaccacaaggaataaaaggcaaagtgggtcccccaggaggaaga
ggctcaaaaggagaaaaaggaaatgaaggactctgtgcctgtgagcctggtcccatgggc
ccccctggacctccaggacttcccgggaggcaggggagtaagggagacttggggctccct
ggctggcttggaacaaaaggtgacccaggacctcctggtgctgaaggacctccagggcta
ccaggaaagcctggtgcctccggaccacccggcaacaaaggggcgaagggtgacgtggtc
atatcaagagttaaagggcacaaaggagaaagaggtcctgatgggcccccaggatttcca
gggcagccaggatcacatggtctggatggacatgctggagaaaaaggggatccaggactc
ccaggggatcatgaagatgcgattccaggtgataaaggatttcctggacctctgggtccc
ccgggcaaagcaggacctgtgggccccccgggactgggatttcctggtccaccaggagag
cgaggccacccaggagttccaggctgcccaggtgtgaggggccctggtggcttgaagggt
cagaaaggtgacacaatttcttgcaacgtaacctatcccgggaggcaaggccctccgggt
tttgatggacctccaggtccaaagggatttccaggtccccaaggtgcccctgggctgagc
ggttcagatgggcataaaggcagacctggcacaccaggaacatcggaaataccaggtccc
cctggtttccgtggtgacataggagatccgggttttggaggtgaaaaggggtcttcccct
gttgggcccccaggcccccccgggtcaccaggagtgaatggtcagaaaggaatcccggga
gaccctgcatttggtcacctgggacccccgggaaggaggggtctttcaggagtgccaggg
ataaaaggacccagaggtgatccgggatatccaggggctgaagggccagctggcattcct
ggattcccaggtctcaaaggtcccaaaggcagagagggacatgctgggtttccaggtgtc
ccaggtccacctggccattcctgtgaaagaggtgctccaggaataccagggcaaccggga
ctccctggggatccaggtagcccaggtgctccaggtgggaaaggacagccaggagatgtg
gggcctcctgggccagctggaatgaaaggtctccctggactcccaggacggcctggggca
catggtcccccgggcctcccaggaatcccaggtccctttggggatgatgggctacctggt
cctccaggtccaaaaggcccccgggggctgcctggtttcccaggttttcccggagaaaga
ggaaagcctggtgcagagggatgtcctggcacaaagggagaacccggagagaagggcacg
tctggctttcccggagaccagggagtgagaggggccaaaggagccataggacctcccgga
gatgaaggagaaatggctatcatttccaaaaagggaaaacccggggaacctggacctcct
ggagatgatggattcccaggagaaagaggtgataaaggaactcccgggatgcaagggaga
agaggagagccgggaagatatggaccaccaggatttcacagaggggaacctggtgagaaa
ggtcagccagggcctcctggacacccaggccctccaggctcaactggtctaagagggttc
attggttttccaggacttccaggtgaccagggtgagccaggttctccaggtccccctgga
ttttcaggaatcgatggagcaacaggacctaaaggaaacaaaggtgaccctgccagtcac
tttggtccacctggtccaaagggtgagccaggtagctctggatgtccagggcattttgga
gcatccggagaccggggcttgcctggcgttcaagggcccagaggatcacccggaaggcca
ggaccacctggctcctctggaccaccagggtgcccaggtgatcaggggatgcctgggctg
aggggacagccaggagaaatgggagaccctgggccaagaggcctccagggggatccaggg
ataccaggtcctccaggaataaaaggtccctccggatcacctggcctgaacggcttacat
ggattgaagggtcagaaaggaaccaaaggtgcttcaggtttgcatgatgtggggccacct
ggtccagtgggaatgcctgggctaaaaggggagagaggagatcctgggagcccaggaatc
tctcctccaggtccttgtggagaaaaaggtctcccaggtcccccagggagatcaggacca
cctggtcctgcaggtgccacaggaagagcacctaaggacattcctgacccgggtccatct
ggagatcagggacctcctggtcccgatggcccaagaggagcacctgggcctccaggcctc
cctgggagtgttgacctcctgagaggggagccaggtgactgtggtctaccagggccacca
ggtctccccggcccaccaggccctccaggatacaaaggctttccaggatgtgatggaaaa
gatggccagaaaggaccaatgggattcccagggccgcagggaccacatggatttcctggg
ccacctggagagaagggtttacctggacctccagggagaaaagggcccactggtcttcca
ggtcccagaggtgaaccggggccacttgcagatgcgaatgactgtccccgaatcccaggg
cttcctggggtgccaggcctgagaggaccagaaggagccatgggactccctggaatgaga
ggccccccaggaccagggtgcaaaggagagcctgggctggacggcaggaggggcatggat
ggcattcctgggtctcctgggcctcccggacgtaaaggtgacacaggagaagacggctat
cccggaggaccagggcctcctggtcccactggggatcctgggcccaaagggtttggcgct
ggatacctcagtggcttcctactggttctccacagtcagacagaccaggagcccacctgc
cccctgggcatgcccaggctctggactgggtatagtctgttatacctggaaggacaagag
aaagctcacaatcaagaccttggtctggcagggtcttgccttcccgtgtttagcacgctg
ccctttgcctactgcaacatccaccaggtgtgccactatgcccagagaaacgacagatcc
tactggctggccagcgctgcacccctccccatgatgccactctctgaagaggcgatccgc
ccctatgtcagccgctgtgcggtatgcgaggccccggcccaggcggtggcggtgcacagc
caggaccagtccatccccccatgtccgcagacctggaggagcctctggattgggtattca
ttcctgatgcacacaggagctggggaccaaggaggagggcaggccctcatgtcacccggc
agctgcctggaagatttcagagcagcaccattccttgaatgccaaggccggcagggaact
tgccacttttttgcaaatgagtatagcttctggctgacaacagtgaaagcagacttgcag
ttttcccctgctccagcaccagacaccttaaaagaaagccaggcccaacgccagaaaatc
agccggtgccaggtctgtgtgaagtatagctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672365
Entry
104672365         CDS       T03989                                 

Gene name
LAMB4
Definition
(RefSeq) laminin subunit beta-4 isoform X1
  KO
K06245  laminin, beta 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104672365 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104672365 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104672365 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672365 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104672365 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104672365 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104672365 (LAMB4)
   05145 Toxoplasmosis
    104672365 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 104672365
NCBI-ProteinID: XP_030788637
LinkDB
Position
6
AA seq 1760 aa
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQNDSLDKYYYALYEMVVRGSCFCNGHASECRPMQKVRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNTCRSCSCNSHSSRCHFDMTMYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTVSGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLSLLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPA
PGYFFAPLNFYLYEAEEATPLQGLAPLGSETFGQSPAVHIVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTVQIVVNPPQGSEHCVPKTSQSKPQS
FALPAATRIMLLPTPICLEPDVQYSLDVYFSQPLEGESHTHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPLVVGRCCDRCSTGSYGLGHHGCHPCHCHPQGSKDTVCDLVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCRPCPCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHFCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCQPCPCNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCR
RCSCHASGVSPAECAPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLIHGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKHCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCLCREGVSGQRCDRYARGHSQEFPTCLQCHLCFDQWDYTISSLSKAVQGLMRLA
ANMEDKRETLPVCKTDFKGLRENMSEIERILKHPVFPSGKFLEVKDYHDSVRKQIMQLNE
QLKAVYEFQDLKHTIERAKNEAGLLLEDLQEEIDLQSSVLNASIVDSSENIKKYYHISSS
AEKKINETSSTINTSANTRNDFLTILNTLTSKGNLSLEKLKQIKIPDIQILNEKVCGDPG
NVPRVVPLPCGGAVCMGREGHSGGAGCHGSLTLSTNALQKAQEAKSVIRNLDKQVRGLKN
QIKNISKLAEVSKNNALQLREKLGNTRNQSDSEEEKINLFIKKVKNFLLEENMPPEDIEK
VANGVLDIHLPIPSQNLTDELDKIQKLMQLCEDYRSDENRLNEEADGAQKLLVKAKAAEK
AANVLLNLDKTLNQLQQAQITHGRANSTITQLTANITKIKKNVLQAENQTREMKNELESA
KQRSGLEDGLSLLQTKLQRHEDHAVNVKVQAESAQHQAGSLEKEFVELKKQYAMLQRKTS
TTGLTKETLGKVKQLKDAAEKLAGDTEDKIRRITDLERKIQDLNLSRQAKADQLRILEDQ
VVAIKNEIVEQEKKYATCYS
NT seq 5283 nt   +upstreamnt  +downstreamnt
atgcaatttcaactgaccctttttttgcaccttgggtggctcagttactcaaaagctcaa
gatgactgcaacaggggtgcctgtcatcccaccaccggcgatctcctggtgggcaggaac
acacagcttacggcttcttctacctgtgggctgagcagagcccagaaatactgcatcctc
agttacctggagggcgaacaaaaatgcttcatctgtgactctagatttccatatgatcca
tacgcccaacccaacagccacaccattgagaatgtcattgtaagttttgaaccagacaga
gaaaagaaatggtggcagtctgaaaatggtcttgatcatgtcagcatcagactggactta
gaggcattatttcggttcagccaccttatcttgacctttaagacttttcggcctgctgca
atgttagttgaacgttccacagactatggacacacctggaaagtgttcaaatattttgca
aaagactgtgccacttcctttcctaacatcacatctggccaggcccagggagtgggagac
attgtttgtgactccaaatactcggatattgaaccctcaacaggtggagaggttgtttta
aaagttttggatcccagttttgaaattgaaaacccttatagcccctacatccaagacctt
gtgacattgacaaacctgaggataaactttaccaagctccacacccttggggatactttg
cttggaaggaggcaaaatgattcccttgataaatactactatgctctgtacgagatggtt
gttcggggaagctgcttttgcaatggccatgctagcgaatgtcgccctatgcagaaggtg
cggggagatgttttcagccctcctggaatggttcacggtcagtgtgtctgtcagcacaat
acagatggtccaaactgtgagagatgcaaggacttcttccaggatgctccttggaggcca
gctgcagacctccaggacaacacttgcagatcgtgcagttgtaacagccactccagccgc
tgtcacttcgacatgactatgtacctggcaagcggtggcctcagcgggggcgtgtgtgaa
gactgccagcacaacactgaggggcagcactgcgatcgctgcaggcccctcttctacagg
gaccccctcaagaccatctcagatccctacgcatgcattccttgtgaatgtgaccctgat
gggaccgtatctggtggtatttgtgtgagccactctgatcctgccttagggtctgtggcc
ggccagtgcctttgtaaagagaacgtggaaggagccaaatgcgaccagtgcaagcccaac
cactatggactgagcgccactgaccccttgggctgccagccctgcgactgtaaccccctt
gggagtctgtcactcttgacctgtgatgtggatacaggccaatgcttgtgcctgtcatat
gtcaccggagcacactgcgaagaatgcactgttggatactggggcctgggaaatcatctc
catgggtgttctccctgtgactgtgatattggaggtgcttattctaacgtgtgttcaccc
aagaatgggcagtgtgaatgccgcccacatgtcactggccgtagctgctctgaaccagcc
cctggctacttctttgctcctttgaatttctatctctatgaggcggaggaagccacgcca
ctccaaggactggcgcctttgggctcggagacttttggccagagtcctgctgttcacatt
gttttaggagagccagttcctgggaaccctgttacatggactggacctggatttgccagg
gttctccctggggctggcttgagatttgctgtcaacaacattccctttcctgtggacttc
accattgccattcgctatgaaacccagtctgcagctgactggactgtccagatcgtggtg
aacccccctcaagggagtgagcactgcgtacccaagacttcacagtcaaagcctcagtct
tttgccttaccagcggctaccagaatcatgctgcttcccacacccatctgtttagaacca
gatgtacaatattccttagacgtctatttttctcagcctttggaaggagagtcccacact
cattcacacgtcctggtggactcccttggccttattccccaaatcaattcattggagaat
ttctgcagcaagcaggacttagatgagtatcagcttcacaactgtgttgaaattgcctca
gcaatgggacctcaagtgctcccgggtgcctgtgaaaggctgatcatcagcatgtccgcc
aagctgcatgatggggctgtggcctgcaagtgtcacccccagggctcagtcggatccagc
tgcagccgacttggaggccagtgccagtgtaaacctcttgtggtcgggcgctgctgtgat
aggtgctcaaccggaagctatggtttggggcatcatggctgtcacccatgtcactgccat
cctcaaggatcaaaggacactgtgtgtgacctagtaacagggcagtgcccctgccatgga
gaggtatctggccgccgctgtgatcgctgcctggcaggctactttggatttcccagctgc
cgcccttgcccttgtaatgggtttgctgaactttgtgatcctgagacggggtcatgcttc
aattgtggaggctttacaactggcagaaactgtgaaaggtgtattgatggttactatgga
aatccttcttcaggacagccctgtcgtccttgcctgtgtccagatgatccctcaagcaat
cagtattttgcccatttctgttatcagaatctgtggagctcagatgtaatctgcaattgt
cttcaaggttatacgggtactcagtgtggagaatgctctactggtttctatggaaatcca
agaatttcaggagcaccttgccaaccatgtccctgcaacaacaatatagatgtaaccgat
ccagagtcctgcagccgggtaacaggggagtgccttcgatgtttgcacaacactcagggt
gcaaactgccagctctgcaaaccaggtcactatggatcagccctaaatcagacctgcaga
agatgctcctgccatgcttctggcgtgagtcccgcggagtgtgcccctggtgggggagct
tgcctctgtgaccctgtcactggtgcatgcccttgtctgccgaatgtcacaggcctggcc
tgtgatcgttgtgctgatggatactggaatctgattcatggcagaggatgtcagtcatgt
gactgtgaccctaggacctctcaaagtagccactgtgaccagcttacaggccagtgtcca
tgtaaattaggctacggcgggaaacattgcagtgagtgccaggaaaattattatggtgat
ccacctgggcgatgcattccatgtgattgcaacagggcgggtacccagaagcccatctgt
gatccagacacaggcatgtgcctctgccgggagggtgtcagcggccagagatgtgatcgc
tatgcccggggtcacagccaggaattccctacttgtcttcaatgtcacttgtgctttgat
caatgggactacaccatttcttccctctccaaagcggtgcaagggttaatgagactggct
gctaacatggaagataaaagagagaccctgcctgtctgtaagacagacttcaaaggcctc
agagagaacatgtctgaaatagaaaggattttgaaacatcctgttttcccatctgggaaa
ttcttagaagtcaaggattatcatgactctgttagaaaacaaatcatgcagctaaatgaa
caattgaaagcagtgtatgaatttcaagatctgaaacatacaatagaaagagcaaagaat
gaagcaggcctcttacttgaagatcttcaggaagaaattgatttgcagtccagtgtcctt
aatgcaagcatagtggactcctcagaaaacatcaagaaatattatcacatatcatcatct
gctgaaaagaaaattaatgaaactagttctaccattaatacctctgcaaataccaggaat
gactttcttaccatcctaaatacactaacctccaaaggaaacttgtcattggaaaaatta
aagcagattaagataccagatatccaaatattgaatgaaaaggtgtgtggagatccagga
aatgtgccacgtgttgtgcccttgccctgtggcggtgctgtctgcatgggccgggaaggg
cacagtgggggtgccggctgtcatggctccctgaccctctcaacgaatgccctccaaaaa
gcccaggaagcaaaatctgttattcgtaatttagataaacaggttcgtggattgaagaat
cagatcaaaaatataagtaaactggcagaagtctccaaaaacaatgccttacagctaagg
gaaaaactgggaaatacaagaaaccaaagtgactctgaagaagaaaaaatcaatcttttc
atcaaaaaagtgaaaaactttttgttagaggaaaacatgcctccagaagacatcgagaag
gttgcaaatggtgtacttgacattcacctaccaattccatcccaaaatctaaccgatgaa
cttgacaaaatacagaaacttatgcaactctgtgaggattacaggtcagatgaaaacagg
ctaaatgaagaagcagatggagcccaaaagcttctagtgaaggccaaagcagctgagaaa
gcagcaaatgttctattaaatcttgacaaaacgttgaaccagttgcaacaagctcaaatc
actcacggacgggcaaattctaccattacacagctgactgccaatataacaaaaataaaa
aagaatgtgctgcaggctgaaaatcaaaccagggaaatgaagaatgagctggagtcagca
aagcagcgatcagggctggaggatggactttccctgctacagaccaagttgcaaaggcat
gaagaccacgctgtcaatgtgaaagttcaggctgaatctgcccaacaccaggctgggagt
cttgagaaggaatttgttgagctgaaaaaacaatatgctatgctccagcgtaagacaagc
actacaggactaacaaaggaaacattaggaaaagttaaacagctaaaagatgctgcagaa
aaattggctggagatacagaggacaagataagaagaataacagatttagaaaggaaaatc
caagatttgaatctaagtagacaagcaaaagctgatcaactgagaatattggaagatcaa
gttgttgccattaaaaatgaaattgttgaacaagaaaaaaaatatgctacgtgctatagc
tag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677415
Entry
104677415         CDS       T03989                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1 isoform X1
  KO
K05636  laminin, beta 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104677415 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104677415 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104677415 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677415 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104677415 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104677415 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104677415 (LAMB1)
   05145 Toxoplasmosis
    104677415 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Other DBs
NCBI-GeneID: 104677415
NCBI-ProteinID: XP_010380739
UniProt: A0A2K6QSI4
LinkDB
Position
6
AA seq 1786 aa
MGLLQVLAFSFLALCGARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQRLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVSGG
VCDDCQHNTMGHNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
LIAGQCRCKLHVEGEHCDVCKEGFYDLSGEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCSAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDDIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPPSSRCGNTIPNDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVMGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GFFGNPSEVGGLCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LQQDCRKCVCNYLGTVQAHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDMMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALSEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEDL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQQSAADIARAEMLLEEAKKASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSADDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQKYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atgggtcttctccaggtgttagctttcagtttcttagccctgtgcggagcccgagtgcgc
gctcaagaacccgagttcagctacggctgcgccgaaggcagttgctaccccgccacgggc
gaccttctcatcggccgagcacagaggctttcggtgacctcgacgtgcgggctgcacaag
cccgagccctactgtatcgtcagccacttgcaggaggacaaaaaatgcttcatatgcaat
tcccaagatccttatcatgagaccctgaatcctgacagccatctcattgaaaatgtggtc
actacatttgcgccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccagctgctatgctgatagaacgatcgtctgactttgggaaaacctgg
ggcgtgtacagatacttcgcctatgactgtgaggcctcgtttccaggcatttcaactggc
cccatgaaaaaagttgatgacataatttgtgattcccgatattctgacattgaaccctca
actgaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agcccaaggatacagaatttattaaaaattaccaacttgagaatcaagtttgtgaaactg
catactttgggagataaccttctggattccagaatggaaatcagagaaaagtattattat
gcagtttatgatatggtggttcgaggaaattgcttctgctatggtcatgccagcgaatgt
gcccctgtggatggattcaatgaagaagtggaaggaatggttcatggacactgcatgtgc
aggcataacacgaagggcttaaattgtgaactctgcatggatttctaccatgatttacct
tggagacctgctgaaggccgaaacagcaacgcctgtaaaaaatgtaattgcaatgaacat
tccagctcatgtcactttgacatggctgtttacctggccacggggaacgtcagcggaggt
gtgtgtgatgactgtcagcacaacacgatggggcacaactgtgagcagtgcaagccgttt
tactaccagcacccagagagggacatccgagatcctaatttctgtgaacgatgtacatgt
gacccagctggctctcaaaatgagggaatttgtgacagctatactgatttttctactggt
ctcattgctggccagtgtcggtgtaaattacatgtggaaggagaacattgtgatgtttgc
aaagaaggcttctatgatttaagtggtgaagatccatttggttgtaaatcttgtgcttgc
aatcctctgggaacgattcctggagggaatccttgtgattccgagacaggtcactgctac
tgcaagcgtctggtgacaggacagcattgtgaccagtgcctgccagagcactggggctta
agcaatgatttggatggatgtcgaccatgtgactgtgaccttgggggagcattaaacaat
agttgctctgcagagtcaggccagtgctcatgtcggcctcacatgattggacgtcagtgc
aatgaagtggaacctggttactactttgccaccctggatcactacctctatgaagcggag
gaagccaacttggggcccggggttagcatagtggagcggcagtacatccaggaccggatt
ccctcctggactggagccggctttgtccgagtgcctgaaggggcttatttggagtttttc
attgatgacataccatattccatggagtatgacatcctaattcgctatgagccacagcta
cccgaccactgggaaaaagctgtcatcacagtgcagcgacctggaaagattccacccagc
agccgatgtggtaataccatccccaatgatgacaaccaggtggtgtcattatcaccaggc
tcaagatacgttgtccttcctcggccagtgtgctttgagaagggaacgaactacacggtg
aggttggagctgcctcaatacacctcctctgatagcgacgtggagagcccctacacgctg
atcgattctcttgttctcatgccatactgtaaatcactggacatcttcaccgtgggaggt
tcaggagatggggtggtcaccaacagtgcctgggaaacctttcagagataccgatgtcta
gagaacagcagaagcgttgtgaaaacgccgatgacagatgtttgcagaaacatcatcttt
agcatttctgccctgttacaccagacaggcctggcttgtgaatgcgaccctcagggttca
ttgagttccgtgtgtgatcccaacggaggccagtgccagtgccggcccaacgtggttgga
agaacctgcaacagatgcgcacctggaacttttggctttggccccagtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgccttctgcaatcctgtcactggccagtgc
cactgtttccagggagtgtatgctcggcagtgtgatcggtgcttacctgggcactgggga
tttccaagttgccagccctgccagtgcaatggccacgccgatgactgcgacccagtgatg
ggggagtgcttgaactgccaggactacactatgggtcataactgtgagagatgcttggct
ggttactatggtgaccccatcattgggtcaggagatcactgccgcccttgcccttgccca
gatggtcccgacagtggacgccagtttgccaggagctgctaccaagatcctgttacttta
cagcttgcctgtgtttgtgatcctggatacattggttccagatgtgacgactgtgcctca
ggattctttggcaatccatcggaagttgggggcttgtgtcagccttgccagtgtcacaac
aacattgacacgacagacccagaagcctgtgacaaggagaccgggaggtgcctcaagtgc
ctgtaccacacggaaggggaacactgtcagttctgccggtttggatactatggtgacgcc
ctccagcaggactgtcgaaagtgtgtctgtaattacctgggtaccgtgcaagcgcactgt
aacggctctgactgccagtgtgacaaagccactggtcagtgcttgtgtcttcctaatgtg
atcgggcagaactgtgaccgctgtgcacctaatacctggcagctggccagtggcactggc
tgtgacccatgcaactgcaacgctgctcattccttcgggccatcttgcaatgagttcaca
gggcagtgccagtgcatgcctgggtttggaggccgcacctgcagcgagtgccaggaactc
ttctggggagaccctgacgtggagtgccgagcctgtgactgtgaccccaggggcattgag
acgccacagtgtgaccagtccacgggccagtgtgtctgcgtggagggtgttgagggtcca
cgctgtgacaagtgcacgcgagggtactcgggggtcttccctgactgcacaccctgccac
cagtgctttgctctttgggacgtgatcattgctgagctgaccaacaggacacacagattc
ctggagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgtgagactgtg
gactcagtggagaggaaagtcagcgagataaaagacatcctggcgcagagccccgcagca
gagccactgaaaaacattgggaatctctttgaggaagcagagaaactgattaaagatgtt
acagaaatgatggctcaagtagaagtgaaattatctgacacaacttcccaaagcaacagc
acagccaaagaactggattctctacagacagaagcggaaagcctagacaacactgtgaaa
gaacttgctgaacaactggaatttatcaaaaactcagatattcggggtgccttggatagc
attaccaagtatttccagatgtctcttgaggcagaggagagggtgaatgcctccaccaca
gaacccaacagtactgtggaacagtcagccctcatgagagacagagtagaagatatgatg
atggagcgagaatcccagttcaaggaaaaacaagaggagcaggctcgcctccttgatgaa
ctggcaggcaagctgcaaagcctagacctttcagctgctgccgaaatgacctgtggaaca
cccccaggggcctcctgttccgagactgaatgtggcgggccaaactgcagaactgatgaa
ggagagaagaagtgtggggggcctggctgtggtggtctggttactgttgcacacaatgcc
tggcagaaagccatggacttggaccaagatgtcctgagtgccctgtctgaagtggaacag
ctctccaagatggtctctgaagcaaaactgagggcagatgaggcaaaacagagtgctgaa
gacattctgttgaagacaaatgctaccaaagaaaaaatggacaagagcaatgaggatctg
agaaatctaatcaagcaaatcagaaactttttgacccaggatagtgctgatttggacagc
attgaagcagttgctaatgaagtactgaaaatggaaatgcctagcaccccacagcagtta
cagaacttgacagaagatatacgtgaacgagttgaaagcctttctcaagtagaggttatt
ctacagcagagtgctgctgacattgccagagctgagatgttgttagaagaagctaaaaaa
gcaagcaaaagtgcaacagatgttaaagtcactgcagatatggtaaaggaagctctggaa
gaagcagaaaaggcccaggtcgcagcagagaaggcaattaaacaagcagatgaagacatt
caaggaactcagaacctgctaacttcgattgagtctgaaacagcagcttctgaggaaacc
ttgttcaacgcgtcccagcgcatcagcgagttagagaggaatgtggaagaacttaagcgg
aaagctgcccaaaactctggggaggcagaatatattgaaaaagtagtatatactgtgaag
caaagcgcagatgatgttaagaagactttagatggtgaacttgatgaaaaatataaaaaa
gtagaaaacttaattgccaaaaaaactgaggagtcagctgatgccagaaggaaagctgaa
atgctacaaaatgaagcaaaaactcttttagctcaagcaaacagcaagctgcaactgctc
aaagatttagaaagaaaatatgaagacaatcaaaaatacttagaagataaagctcaagaa
ttagcaagactggaaggagaagtccgttcactccttaaggatataagccagaaagttgct
gtttatagcacgtgcttgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678039
Entry
104678039         CDS       T03989                                 

Definition
(RefSeq) laminin subunit alpha-3 isoform X2
  KO
K06240  laminin, alpha 3/5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104678039
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104678039
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104678039
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104678039
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104678039
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104678039
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104678039
   05145 Toxoplasmosis
    104678039
SSDB
Motif
Pfam: Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_G_3 Laminin_EGF
Other DBs
NCBI-GeneID: 104678039
NCBI-ProteinID: XP_010381530
UniProt: A0A2K6PND1
LinkDB
Position
21
AA seq 1724 aa
MPPAVRRSARSMGWLWIFGAALGQCLGYSSQQQRVPFLQPPGQSQLQASYVEFRPSQGCS
PGYYRDHKGLYTGRCVPCNCNGHSNRCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHG
SCRACPCPHTNRFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSC
NSNGQLGSCDPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQG
LSASAELLEQMRHVETQAKDLRNQLLNYRSAISNHGSKIEGLERELTGLNQEFETLQEKA
QVNSRKAQTLYNNVNRAIQSAKELDMKIKTVIRNVHILLKQISGTDGEGNNVPSGDFSRE
WAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLN
EYEAKLSDLRARLQEAAARAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTSADS
SLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHAQSL
QELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIK
EDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVHLALSNLQQTLNIVTVQKEVIATNLTTL
RDGLRGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGSTQTEDFK
KALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAV
PMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYI
GMAVVDGQLTCVYNLGDRETELQVDQILTESETQEAVMDRVKFQRIYQFARLNYTKGATS
SKPEIPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLRFPPYKGCIELDDLNE
NVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHASIPTFGQTIQTT
VDRGLLFFTENGDRFISLNIEDGKLMVRYKLNSEPPKERGVGDAINNGRDHSIQIKIGKV
QKRMWINVDFQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVR
LNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTNLGSPLTDHLQASFGFQTFQPSGVLLSL
QTRTSTLQVTLEDGHIELSTRDSDGPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQPL
RNGQRPKRISSSQQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLASNSLKRDVSLGGCSL
NKPPFLMLLQGSTRFNKAKTSRINQLLQDTPVASPRSMKVWQDACSPLPRTQANHGALQF
GDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALG
TDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTVSIRGPVYLG
SPPSGKPKSLPTNSFVGCLKNFQLDSKPLDTPSSSFGVSSCLGGPLEKGIYFSEEGGHVI
LAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTS
VTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLT
TLRIPVWKSFFGCLRNIFVNHIPVPVTEALEVQGPVSLNGCPDH
NT seq 5175 nt   +upstreamnt  +downstreamnt
atgcctccagcagtgaggcggtcagcccgcagcatgggatggctgtggatctttggggca
gccctggggcaatgtctgggctacagttcacagcagcaaagggtgccatttcttcagcct
cccggtcaaagtcaactgcaagcgagttatgtggagtttagacccagccagggttgtagc
cctggatattatcgggatcacaaaggcttgtataccggacggtgtgttccctgcaattgc
aacggacattcaaatcgatgccaggatggctcaggcatatgtgttaactgtcagcacaac
accgcgggggagcattgtgaacgctgccaggagggctactatggcaacgccgtccacgga
tcctgcagggcctgcccgtgtcctcacaccaacaggtttgccaccggctgtgtggtgaac
gggggagacgtgcggtgctcctgcaaagctgggtacacaggaacacagtgtgaaaggtgt
gcaccgggatatttcgggaatccccagaaattcggaggtagctgccaaccatgcagttgt
aacagcaatggccagctgggcagttgtgatcccctgactggagactgcataaaccaagaa
cccaaagatagcagccctgcagaagaatgtgatgattgcgacagctgtgtgatgaccctc
ctgaatgacctggccaccatgggcgagcagctccgcctggtcaagtctcagctgcagggc
ctgagtgccagcgcggagcttctggagcagatgaggcacgtggagacccaggccaaggac
ctgaggaatcagttgctcaactaccgttctgccatttcaaatcatggatcaaaaatagaa
ggcctggaaagagaactgactggtctgaatcaggaatttgagactttgcaagaaaaggct
caagtaaattccagaaaagcacaaacattatacaacaatgttaatcgggcgatacaaagc
gcaaaagaactggatatgaagattaaaactgtcatccggaatgtgcacattctcttaaag
cagatctcggggacagatggagagggaaacaacgtgccttcaggtgacttttccagagag
tgggctgaagcccagcgcatgatgagggaactgcggaacaggaactttggaaagcacctg
agagaagcagaagctgataaaagggagtcacagctcttgctgaaccggataaggacctgg
cagaaaacccaccagggggagaacaacgggcttgctaatagtatacgggattctttaaat
gaatacgaagccaaactcagtgaccttcgtgctcggctgcaggaggcagctgcccgagcc
aagcaggcaaatggcttgaaccaagaaaatgagagagctttgggagccatccagagacaa
gtaaaagaaataaattccctgcagagtgatttcaccaagtatctaacctctgcagactca
tctttgttgcaaaccaacattgcactgcagctgatggagaaaagccagaaggaatatgaa
aaattagctgccagtttaaatgaagcaagacaagaactaagtgacaaagtaagagaactt
tccagatctgctggcaaaacatcccttgtggaggaggcagaaaagcacgcgcagtcctta
caagagctggcaaagcagctggaagagatcaagagaaatgccagcggggatgagctggtg
cgctgtgctgtggatgccgccaccgcctatgagaacatcctcaacgccatcaaagcggct
gaggacgcggccaacagggctgccagtgcatctgaatctgccctccagacagtgataaag
gaagatctgccaagaaaagctaaaaccctgagttccaacagtgataaactgttaaatgaa
gccaagatgacacaaaagaagctaaagcaagaagtccatctggctctcagcaacctacag
caaaccctgaatattgtgacagttcagaaagaagtgatagccaccaatcttacaactctc
cgagatggtcttcgtgggatacagagaggtgatattgatgctatgatcagtagtgcaaag
agcatggtcagaaaggccaacgacatcacagatgaggtcctggatgggctcaaccccatt
cagacagatgtggaaagaattaaggacacctatgggagcacacagaccgaagacttcaaa
aaggctctgactgatgcagataactcggtgaataagttaaccaacaaactacctgatctt
tggcgcaagattgaaagtatcaaccaacagctgttgcccttgggaaacatctctgacaac
atggacagaatacgagaattaattcagcaggccagagatgctgccagtaaggttgctgtc
cccatgagattcaatggtaaatctggagttgaagtccgactgccaaatgacctggaagat
ttgaaaggatacacatctctgtccttgtttctccaaaggcccaactcaagagaaaatggg
ggtactgagaatatgtttgtgatgtaccttggaaataaagatgcctcccgggactacatc
ggcatggcagttgtggatggtcagctcacctgtgtctacaacctgggggaccgtgagact
gaactccaagtggaccagatcttgaccgagagtgagactcaggaggcagttatggatcgg
gtgaaatttcagagaatttatcagtttgcaaggcttaattacaccaaaggagccacatcc
agtaaaccagaaatacccggagtctatgacatggatggtagaaacagcaatacactcctt
aatttggatcctgaaaatgttgtattttatgttggaggttacccacctgattttaaactt
cccagtcgactaaggttccctccatacaaaggttgtattgaattagatgacctcaatgaa
aatgttctgagcttatacaacttcaaaaaaacattcaatctcaacacaacggaagtggag
ccttgtagaaggaggaaggaagagtcagacaaaaattattttgaaggtacgggctatgct
cgagttccaactcaaccacatgcttccatcccaacctttggacagacaattcagaccact
gtggatagaggcttgctgttcttcacagaaaacggggatcgcttcatatctctgaatata
gaagatggcaagctcatggtgagatacaaactgaattcagagccaccaaaagagagagga
gttggagacgccataaacaacggcagagatcattcgattcagatcaaaattggaaaagtc
caaaagcgtatgtggataaatgtggactttcaaaacactataattgatggtgaagtattt
gatttcagcacatattatctgggaggaattccaattgcaatcagggaaagatttaacatt
tctacgcctgctttccgaggctgcatgaaaaatttgaagaaaaccagtggtgtcgttaga
ttgaacgatactgtgggagtaaccaaaaagtgctcggaagactggaagcttgtgcgatct
gcctcattctccagaggaggacagttgagtttcactaatttgggctcaccgcttactgac
cacctccaggcctcatttggatttcagacttttcaacccagtggcgtattattaagtctt
cagacacggacaagcaccctgcaggtcactctggaagatggtcacattgaattgagcacc
agggatagcgacggcccaatttttaaatctccacaaacatatatggatggtttgctgcac
tatgtatctgtaataagcgacaactctggactacggcttctcattgatgaccagcctctg
agaaatggccaaaggccaaaacgcatttcaagttcccagcagtctctgcgtctgggcggg
agcaattttgagggttgtatcagcaatgtttttgtccagaggttatcactgagtcccgaa
gtcctagatttggccagtaactctctcaagagagatgtgtccctgggaggctgcagttta
aacaaaccaccttttctaatgttgcttcagggttctaccaggtttaacaaggccaagact
tcccgtatcaatcagctgttgcaggacacaccagtggcctccccaagaagcatgaaagtg
tggcaagatgcctgttcaccacttcccaggacccaggccaatcatggagccctccagttt
ggggacattcccaccagccacttgctattcaagcttcctcaggagctgctgaaacccagg
tcacagtttgctgtggacatgcagacaacatcctccagaggactggtgtttcacacgggc
actaagaactcctttatggctctttatctttcaaaaggacgtctggtctttgcactgggg
acagatgggaaaaaattgaggatcaaaagcaaggagaaatgcaatgatgggaagtggcac
acggtggtgtttggccatgatggagaaaaggggcgcttggttgtggatggactgagagcc
cgggagggaagtttgcctggaaactccaccgtcagcatcagaggaccagtttacctggga
tcgcctccatcagggaaaccaaagagccttcccacaaacagctttgtgggatgcttgaag
aactttcagctggattcaaaacccttggataccccttcttcaagcttcggggtgtcttct
tgcttgggtggtcctttggagaaaggcatttatttctccgaagaaggaggtcatgtcatc
ttggctcactctgtgttgctggggccagaatttaagcttgttttcagcatccgcccaaga
agtctcactgggatcctaatacacatcggaagtcagcctgggaagcacttatgtgtttac
ctggaggccggaaaggtcacggcctctatggacagtggggcaggcgggacctcgacctca
gtcacaccaaagcagtctctgtgtgatgggcagtggcactcggtggcagtcaccataaaa
caacacatcctgcacctggaactggacacagacagtagctacacagctggacagatcccc
ttcccacctgccagcactcaagagccactacaccttggaggtgctccagccaatttgacg
acactgaggatccctgtgtggaaatcattctttggctgtctgaggaatatttttgtcaac
cacatccctgtccctgtcactgaagccttggaagtccaggggcctgtcagtctgaatggc
tgtcctgaccactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679242
Entry
104679242         CDS       T03989                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04974  Protein digestion and absorption
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104679242 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104679242 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104679242 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104679242 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    104679242 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679242 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104679242 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104679242 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104679242 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104679242 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104679242 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104679242 (COL4A1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104679242 (COL4A1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104679242 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 104679242
NCBI-ProteinID: XP_010383047
UniProt: A0A2K6NU22
LinkDB
Position
18
AA seq 1669 aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGL
PGNPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGS
PGFPGEPGYPGLVGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGP
KGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGASLPGPSGRDGLPGPPGSPG
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGLIGEIGEKGQKGESCLICDTTGYRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEIYFDLRLK
GDKGDPGFPGQPGIPGRAGSPGRDGRPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDT
GPPGPPGYGPTGPIGDKGQAGFPGGPGSPGLPGPKGEPGKVVPLPGPPGAEGLPGSPGFP
GPQGDRGFPGTPGRPGLPGEKGAVGQQGIGFPGPPGPKGVDGLPGDVGPPGTPGRPGFNG
LPGNPGVQGQKGEPGVGLPGLKGLPGLPGIAGTPGEKGSVGVPGVPGEHGAIGPPGLQGI
RGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPG
PKGDKGSQGLPGVTGQSGLPGLPGQQGSPGIPGFPGSKGEMGVMGTPGQPGSPGPVGVPG
LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIG
PIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPG
TPGEKGVPGIPGPQGSPGSPGEKGAKGAKGQAGPPGIGIPGLPGEKGDQGIAGFPGSPGE
KGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSP
GIPGSKGEQGFMGPPGPQGQPGLPGSPGRATEGPKGDRGPQGQPGLPGLPGPMGPPGLPG
IDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKG
LPGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGPPGPK
GQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPTGPTGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggctgctgctgctgcccgccgcccttctgctccacgag
gagcacagccgggccgctgcgaagggtggctgtgctggctctggctgtggcaaatgtgac
tgccatggagtgaagggacaaaagggcgaaagaggcctcccagggttacaaggtgtcatt
gggtttcctggaatgcaaggacctgaggggccgcagggaccaccaggacaaaagggtgat
actggagaaccaggactacctggaacaaaagggacaagaggacccccgggagcatctggc
taccctggaaacccaggacttcccggtattcctggccaagacggcccaccaggcccccca
ggtattccaggatgcaatggcacaaagggagagagagggccgctcgggcctcctggcttg
cctggtttcgctggaaatcccggaccaccagggttaccaggaatgaagggtgatccaggt
gagatacttggccatgtgcccgggatgctgttgaaaggtgaaagaggatttcccggactc
ccagggaatccaggtccaccaggattgccaggacttcaaggtcctgttgggcctccagga
tttaccggaccaccgggtcctccaggtcctcccggccctccaggtgaaaagggacaaatg
ggcttaagttttcaaggacccaaaggtgacaagggtgaccaaggggtcagtgggcctccg
ggagtaccaggacaagcccaagttcaagaaaaaggagattttgccaccaagggagaaaag
ggccaaaaaggtgaacctggatttcagggaatgccaggggtcggagagaaaggtgaaccc
ggaaaaccaggacccagaggaaaacctggaaaagatggtgacaaaggggaaaaagggagt
cccggttttcctggtgaacccgggtacccaggactcgtaggccgccagggcccgcaggga
gaaaagggtgaagcaggtcctcctggcccaccaggaattgttataggcacagggcctttg
ggagaaaaaggagagcggggctaccctggaactccagggccaagaggagagccaggcccg
aaaggtttcccaggactaccaggccaacccggacctccaggcctccctgtacctgggcag
gctggtgcccctggcttccctggtgaaagaggagaaaaaggtgaccgaggatttccgggt
gcatctctgccaggaccaagtggaagagacgggctcccgggtcctcctggttcccccggg
ccccctgggcagcctggctacacaaatggaattgtggaatgtcagcccggacctccaggt
gaccaaggtcctcctggaattccagggcagccaggattgataggcgaaattggagagaaa
ggtcaaaaaggagagagttgcctcatctgtgatacaactggatatcgggggcctcccggg
ccacagggacccccaggagaaataggtttcccaggacagccaggggccaagggcgacaga
ggtttgcctggcagagatggtgttgcaggagtgcctgggcctcaaggtacaccagggctg
ataggccagccaggagccaagggggagcctggtgagatttatttcgacctgcggctcaaa
ggtgacaaaggagacccaggctttccaggacagcccggcataccagggagggcgggttct
cctggaagagatggccgtccgggtcttcctggccccaagggctcgccgggttctgtagga
ttgaaaggagagcgtggcccccctggaggagttggattcccaggcagtcgtggtgacacc
ggcccccctgggcctccaggatatggtcctactggtcccattggtgacaaaggacaagca
ggctttcctggaggccctgggtccccaggcctgccaggtccaaagggtgaaccaggaaaa
gttgttcctttaccaggcccccctggagcagaaggactgccggggtccccaggcttccca
ggtccccaaggagaccgaggctttcctggaaccccaggaaggccaggcctgccaggagag
aagggtgctgtgggccagcagggaattggatttccagggccccctggccccaaaggtgtt
gacggcttacctggagatgtggggcctccagggactccaggtcgcccgggatttaatggc
ttacctgggaacccaggtgtgcagggccagaagggagagcctggagttggtctgccagga
ctcaaaggtttgccaggtctacccggcattgctggcacacccggggagaaggggagcgtt
ggggtaccaggcgttcctggagaacacggagcgatcggaccccctgggcttcaggggatc
agaggtgaaccggggcctcctggattgccaggctccgtggggtctccaggagttccagga
attggcccccctggagctaggggcccccctggaggacagggaccaccgggattgtcgggc
cctcctggaataaaaggagagaagggtttccccggattccccggactggacatgccaggc
cctaaaggagataaagggtctcaaggacttcctggcgtaacaggacagtcagggctccct
ggccttcctggacagcaggggtctcctggcattcctgggtttccaggttccaagggagaa
atgggcgtcatggggacccccgggcagccgggctcaccaggaccagtgggtgttccggga
ttaccgggtgaaaaaggggaccatggctttccgggctcctcaggacccaggggagaccct
ggcctgaaaggtgataagggggatgtcggtctccctggcaagcctggctccatggataag
gtggacatgggcagcatgaagggccagaagggagaccaaggagagaaaggacaaattgga
ccaattggtgagaaaggatcccgaggagaccctgggaccccaggagtgcctggaaaggat
gggcaggcaggacagcctgggcagccaggaccgaaaggtgatccaggtataagtggaacc
ccaggtgctccaggacttccgggaccaaaaggatctgttggtggaatgggcttgccagga
acacctggagagaaaggtgtgcctggcatccctggcccacaaggttcacctggctcacct
ggagaaaaaggtgcaaaaggagcgaaagggcaggcaggcccacctggcataggcatccca
gggctgcctggtgaaaagggagatcaagggatagcgggtttcccaggaagccctggagag
aagggagaaaaaggaagcattgggatcccaggaatgccagggtccccaggccttaaaggg
tctcctgggagtgttggctatccagggagccctgggctgcctggagaaaaaggtgacaaa
ggcctcccaggattggatggcatccctggtgtcaaaggagaagcaggtcttcctgggacg
cctggccccacaggcccagctggccagaaaggggagccaggcagtgacggaatcccgggg
tcagcaggagagaagggtgaaccaggtctaccaggaagaggattcccagggtttccaggg
gccaaaggagacaaaggttcaaagggcgaggtgggtttcccaggattagccgggagccca
ggaattcctggatccaaaggagagcaaggattcatgggtcctccagggccccagggacaa
ccagggttaccaggatccccaggccgtgccacggaggggcccaaaggagaccgtggacct
cagggccagcctggcctgccaggacttccgggacccatggggcctccggggcttcctggg
attgatggagttaaaggtgacaaaggaaatccaggctggccaggagcacccggtgtccca
gggcccaagggagaccctggattccagggcatgcctggtattggtggctctccaggaatc
acaggctctaagggtgatatggggcctccaggagttccaggatttcaaggtccaaaaggt
cttcctggcctccagggaattaaaggtgatcaaggcgatcaaggtgtcccgggagctaaa
ggtctcccgggtcctcctggccccccaggtccttacgacatcatcaaaggggagcccggg
ctccctggtcctgagggtcccccagggctgaaagggcttcagggacctccaggccccaaa
ggccagcaaggtgttacaggattggtgggtatccctggacctccaggtatccctgggttc
gacggtgcccctggccagaaaggagagatgggacctaccgggcctactggtccaagagga
tttccaggtccaccaggccctgatgggttgccagggtccatggggcccccaggcacccca
tctgttgatcatggcttccttgtgaccaggcacagtcaaacaatagacgacccacagtgt
ccctctgggaccaaaattctttaccatgggtactctttgctctacgtgcaaggcaacgaa
cgggcccatggccaggacttgggcacggccggcagctgcctgcgcaagttcagcacaatg
cccttcctgttctgcaatattaacaacgtgtgcaactttgcatcacgaaatgactactcg
tactggctctccacccccgagcccatgcccatgtcaatggcacccatcacgggggacaac
ataagaccatttattagtaggtgtgctgtgtgtgaggcgcccgccatggtgatggccgtg
cacagtcagaccattcagatcccaccgtgccccagcgggtggtcctcgctgtggatcggc
tactcttttgtgatgcacaccagcgctggtgcagaaggctctggccaagccctggcatcc
cctggctcctgtctggaggagtttagaagtgcgccattcatcgagtgtcacggccgtggg
acctgtaattactatgcaaatgcttacagcttttggctcgccaccatagagaggagcgag
atgttcaagaagcccacgccgtccaccttgaaggcaggggagctgcgcacacatgtcagc
cgctgccaagtctgtatgagaagaacataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679243
Entry
104679243         CDS       T03989                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04974  Protein digestion and absorption
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104679243 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104679243 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104679243 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104679243 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    104679243 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679243 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104679243 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104679243 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104679243 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104679243 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104679243 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104679243 (COL4A2)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104679243 (COL4A2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   104679243 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 104679243
NCBI-ProteinID: XP_030778225
LinkDB
Position
18
AA seq 1712 aa
MGRDQRAVAGPALRRWLLLGTVTVGFLAQGVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPREERD
RYRGEPGEPGLVGFQGPPGRPGPVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKG
EKGDVGQPGPNGIPSDLLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGF
PGLRGYPGLSGAKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDLGPPGLPAYSPHPSLAKG
ARGDPGFPGAQGEPGSQGEPGDPGPRGPPGLSIGDEDQRRGLPGEMGPKGFIGDPGIPAL
YPGPPGPDGRPGPPGPPGLPGPPGPDGFLFGLKGAEGRAGFPGLSGSPGARGPKGWKGDA
GDCRCAEGDEPVRGPPGLPGPKGFAGINGEPGRKGDKGDPGQHGLPGFPGLKGVPGNVGA
PGPKGAKGDSRTITTKGERGQPGVPGVPGMKGDDGGPGRDGLDGFPGLPGPPGDGIKGPP
GDAGYPGIPGTKGTPGEVGPPGLGLPGFKGQRGFPGDAGLPGPPGFPGPPGPAGTPGQRD
CDTDVKRPIGGDRQEAIQPGCVGGPKGLPGLPGPPGPSGAKGLRGIPGFSGADGGPGPKG
LPGDPGREGFPGPPGFIGPRGSKGAVGLPGPDGPPGPIGLPGPDGPPGDRGLPGEVLGAQ
PGPRGDAGVPGQPGFKGLPGDRGPPGFRGSQGMPGMPGPKGQPGLPGPSGQPGLSGPPGQ
HGFPGAPGQEGPLGLPGIPGLEGLPGDRGDPGDIGAPGPVGMKGLSGDRGDAGLAGERGH
PGSPGFKGIDGMPGTPGLKGERGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGV
AGEPGFKGSRGDPGPPGPPPIILPGMKDIKGEKGDEGPMGLKGYLGAKGIPGMPGIPGLS
GIPGLPGRPGHIKGVKGDIGAPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL
YGEIGPTGDFGDIGDTINLPGRPGLKGEQGTAGIPGLKGFFGEKGTEGDIGFPGITGVTG
VQGPPGLKGQTGFPGLTGPPGSQGQPGRIGLPGGKGDDGWPGTPGLPGFPGLRGIRGLHG
LPGTKGFPGSPGADIHGDPGFPGPPGDRGDPGDANTLPGPVGVPGQKGEQGAPGERGPPG
SPGLQGFPGITPPSNISGVPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPG
TPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPAGAVGDRGPKGPKGDPGFPG
APGIVGAPGIAGIPQKIAIPPGTVGPQGRRGPPGAQGEMGPQGPPGEPGFRGAPGKVGPQ
GRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSASIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5139 nt   +upstreamnt  +downstreamnt
atggggagagaccagcgcgcggtggccggccctgccctacggcggtggctgctgctgggg
acagtgaccgtggggttccttgcccagggcgtcttggcgggtgtgaagaagtttgatgtg
ccgtgcggaggaagagattgcagtgggggctgccagtgctaccctgagaaaggtggacgt
ggtcagcctgggccagtggggccccaggggtacaatgggccaccaggattacaaggattc
ccaggactgcagggacgcaaaggagacaagggtgaaaggggagcccccggaataacagga
cccaagggcgacgtgggagcaagaggcgtttctggattccctggtgccgatggaattcct
ggacacccggggcaaggtgggcccaggggaaggcccggctatgatggctgcaacggaacc
cagggagactcaggtccacaggggccccccggctctgaggggttcaccgggcctcccggg
ccccaaggaccaaaagggcagaaaggtgagccttatgcactgcctagagaggaacgcgac
agatatcggggcgaacctggagagcctggattggtcggtttccagggacctcccggccgc
cctgggcctgtggggcagatgggcccagttggagctccagggagaccaggaccacccgga
ccccctggaccaaaaggacagcaaggcaacagaggacttggtttctacggagttaagggt
gaaaagggtgacgtagggcagccaggacccaatgggattccatcggaccttctccacccc
atcatcgcgcccacaggagtcaccttccacccagatcagtacaagggtgaaaaaggcagt
gagggggaaccaggaataagaggcatttccttgaagggagaagaaggaatcatgggcttt
cctggactgaggggttaccctggtttgagcggtgcaaaaggatcgccaggacagaaggga
agccgaggcctggatggctaccaaggccctgatgggccccggggacccaagggagaagcc
ggagacctagggccccctggactacctgcctactcccctcacccttccctagcaaaaggt
gccagaggtgacccgggattcccaggggcccaaggggagccaggaagccagggtgagcca
ggagacccgggcccccgaggaccccctggcctctccatcggagatgaagatcagaggaga
ggcctgccgggtgagatgggacccaagggcttcatcggagaccccggcatccctgcgctg
tacccgggcccacctggacctgatggaaggccagggcctccaggcccccccgggctccct
ggaccacctggacctgatggcttcctgtttgggctgaaaggagcagaaggaagagcaggc
tttcctgggctttccggctcccctggagcccgcggaccaaagggatggaaaggtgacgct
ggggactgcagatgtgcagaaggcgacgaacctgtcagaggtcctccaggactgccagga
cccaagggctttgcaggcatcaacggggagccggggaggaaaggggacaaaggagacccc
ggccaacatggcctccctgggttcccagggctcaagggagtccctggcaacgttggtgct
cctgggcccaaaggagcaaaaggagattccagaacaatcacgaccaaaggtgagcgggga
cagcccggcgtcccaggtgtgcccgggatgaaaggtgatgatggcggcccaggccgcgat
gggctcgatggattccccggcctcccaggccctcccggcgatggcatcaagggccctccc
ggggacgcaggctatccaggaatacctggaacgaaaggtactccgggagaagtgggtccc
ccaggactgggccttcccggcttcaaaggccagcgtggtttccctggagacgccggctta
cctggaccaccaggcttcccgggccctcctggccccgcagggaccccaggacaaagagat
tgtgacacagatgtgaaaaggcccattggaggtgacagacaggaggccatccagccaggt
tgcgtaggagggcccaagggattaccaggcctgccaggacccccaggaccctcaggtgcc
aaaggcctccgaggaatcccaggcttctcaggagctgatggaggaccagggcccaagggt
ttgccaggagacccaggtcgtgaagggttcccaggacccccagggttcataggaccccga
ggatccaaaggtgcagtgggcctccctggcccagatggacccccaggtcccatcggcctg
ccagggccagacgggccccctggggacaggggccttcctggagaagtcctgggagcccag
cccggaccacggggagatgctggtgtgcctggacagcctgggtttaaaggccttcccgga
gacagaggcccccctggattcagaggaagtcaagggatgcctgggatgccagggccgaag
ggccagccgggccttccgggaccttccggccagccaggcctgtccgggcctccaggacag
catggattcccaggagctcctggccaagaggggcccttggggctgccaggaatcccaggt
cttgaaggtctgcctggagatagaggggaccctggggacataggcgctcctggccctgtg
ggcatgaaaggtctctctggtgacagaggggatgcaggcttggcaggggagcgaggccat
ccaggaagccctggatttaaaggaattgatggaatgcctgggacccctgggctaaaagga
gagagaggctcacctgggatggatggtttccagggcatgcctggactcaaagggagaccc
ggctttccagggagcaaaggcgaggctggatttttcggaataccgggtctgaagggtgtg
gctggtgagccaggttttaaaggcagccgaggggaccctgggcccccaggaccacctccc
atcatcctgccaggaatgaaagacattaaaggagagaaaggagacgaagggcctatggga
ctgaaagggtacctgggcgcaaaaggtatcccaggaatgccaggcatcccaggactgtca
ggaatccctgggctgcctgggaggcccggccacatcaaaggagtcaaaggagacatcgga
gccccgggcatccctggtttgccaggattccctggggtggctggcccccctggaattaca
gggttcccaggattcataggaagccggggtgacaaaggcgccccagggagagcaggcctg
tatggcgagatcggcccgaccggtgatttcggtgacatcggggacactataaatttacca
ggaagaccaggcctgaagggggagcagggcaccgctggaataccaggtctgaagggattc
tttggagagaagggaacagaaggtgacatcggcttccctgggataacaggcgtgaccgga
gtccaaggccctcctgggcttaaaggacaaacaggctttccagggctaactgggcctcca
gggtcgcagggacagccggggcggattggactgcctggtggcaaaggagatgatggctgg
ccgggaactccaggcttaccaggttttccgggactccgtgggatccgcggcttacacggc
ttgccaggcaccaaaggctttccaggatccccaggtgccgacatccacggagacccaggc
ttcccaggccctcctggggacagaggtgacccaggagacgccaacacccttccaggccct
gtgggagtcccaggacagaaaggagagcaaggagctccaggggaacgaggcccacctggg
agtccaggacttcaggggttccccggcatcacgcccccttccaacatctctggggtacct
ggtgacaaaggggcgccagggatatttggcctgaaaggttatcggggcccgccagggcca
cccggatctgctgctcttcctggaagcaaaggtgacacagggaacccaggagctccagga
accccagggaccaaaggatgggccggggactccgggccccagggcaggcctggtgtgttc
ggtctcccgggagaaaaagggcccaggggtgaacaaggctttatggggaacactggaccc
gccggcgcggtgggcgacagaggccccaagggacccaagggagacccaggattccctggt
gcccccgggattgtgggagcccctggaattgcaggaatcccccagaagattgccatccca
ccagggacagtgggtccccaggggaggcgaggcccccctggggcacaaggggagatgggg
ccccagggccctcccggagaaccaggtttccgtggggctccagggaaagtcgggccccaa
ggaagaggtggcgtgtctgctgttcccgggttccggggagatgaaggacccataggccac
caggggccgattggccaagaaggggcgccaggccgtccggggagcccaggcctgccgggt
atgccaggccgcagcgccagcatcggctacctcctggtgaagcacagccagacagaccag
gagcccatgtgcccggtgggcatgaacaagctctggagtgggtacagcctgctgtacttc
gagggccaggagaaggcacacaaccaggacctggggctggcgggctcctgcctggcgcgg
ttcagcaccatgcccttcctgtactgcaaccctggtgatgtctgctactacgccagccgg
aacgacaagtcctactggctctctaccactgctccgctgcccatgatgcctgtggccgag
gatgagatcaagccctacatcagccgctgctctgtgtgtgaggccccagccgtcgccatt
gccgtccacagtcaagatgtctccattccacactgcccagcggggtggcggagtttgtgg
atcggatattccttcctcatgcacacggcggcgggagacgaaggcggcggccagtcactg
gtgtcaccgggcagctgtctggaggacttccgcgccacgccattcatcgagtgcaatgga
ggccgcggcacctgccactactacgccaataagtacagcttctggctgaccaccattccc
gagcagagcttccagggctcgccctccgctgacacgctcaaggccggcctcatccgcaca
cacatcagccgctgccaggtgtgcatgaagaacctgtga

DBGET integrated database retrieval system