KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655298
Entry
104655298         CDS       T03989                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2 isoform X1
  KO
K05637  laminin, alpha 1/2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104655298 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104655298 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655298 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655298 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104655298 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104655298 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104655298 (LAMA2)
   05414 Dilated cardiomyopathy
    104655298 (LAMA2)
   05416 Viral myocarditis
    104655298 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104655298 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104655298 (LAMA2)
   05145 Toxoplasmosis
    104655298 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 LXG DUF948 HSBP1
Other DBs
NCBI-GeneID: 104655298
NCBI-ProteinID: XP_030784658
LinkDB
Position
4
AA seq 3224 aa
MPGAAGVLLLLLLSGGLRGGQAQLPQQQRRPQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRSLSLNIHGKYIGGGVCINCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCNPTG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCNCKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLSGRIRVAPQQDDSDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTEHVLQFMIILEGNDLRISTAQDEVYLHPSEEHINVLVLKEESF
TIHGTHFPVSRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSVAAA
VEVCQCPPGYTGSSCEKRHQANASSNLIPANNTKSCWPRHRRVNGTIFGGICEPCQCFGH
AESCDDVTGECLNCKDHTGGPYCDKCLPGFYGDPTKGTSEDCQPCACPLNIPSNNFSPTC
HLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSL
SGSCLICKPGTTGRYCELCADGYFGDAVDARNCQPCHCNANGSFSEICHRQTGQCECRAN
VQGQRCDKCKPNMWWDPEKRFCVLCDCDPVGSVSPQCDITGRCVCKTDFVGKQCNLGRQV
HQQEEQPQRAQRVLGSPQRWAIGSSSGCPRGAYRAPAPPGTFGLQSARGCVPCNCNSFGS
KSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLGNNCDPKTGRCICPP
NTIGEKCSKCAPNTWGHSITTGCKTCNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECS
RGHWNYPRCNLCDCFLPGTDAATCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCQPGKFG
LDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIAFQH
PEIVAHMDLMREDLRWEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYNPQV
IIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVHRTVTREDFLDILY
DIHYILIKATYGNFMRQSRISEISMEVAEQGRRTAVTPPAHLIEKCDCPLGYSGLSCEAC
LPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALG
YYGIVKGLPNDCQQCACPLISSSNNFSPSCVTEGLDDYRCTACPRGYEGQYCERCAPGYT
GSPSSPGGSCQECECDPYGSLPVPCDPVTGICTCRPGATGRKCDGCKHWHAREGWECVFC
GDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMIQELKHLLSPQQAPERLIQ
LAEGDLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNE
KAIKLNETLGTRDEAFERNLERLQKEIDQMIKELRRRNLETQKEIAEDELVAAEGLLKKV
KKLFGESRGKNEEMEKDLREKLADYKNKVDDAWDLLREATNKIREANRLFAVNQKNMTAL
EKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNNKI
DDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDY
IDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGSLQKSFRILNEAKKLANDVKENEDH
LNGLKTRIENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQ
IKQLHQNLDGLKKNYDKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLK
PIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNV
KTAVADNLLFYLGSAKFIDFLAIEMRRGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIMA
SRTGRNGTISVRALDGPKASIVPSTYHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAV
RVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRP
IRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVGN
QNHNDGKWKSFTLSRIQKHANISIVDIDTNQEENIATSSSGNNFGLDLKADDKIYFGGLP
TLRNLRPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVE
LSPVPVDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQAYYAILLNRGRLEVH
LSTGARTMRKIVVRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPLEVK
KLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSVPMDFARPVSFKNADIGRCVHQKLRED
EDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSKQFGLSRNSHIAIAF
DDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSYDLGSGDTNTMI
PTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPRKADILDVVGMLYVGGLPINYTTRR
IGPVTYSIDGCIRNLHMEEAPADLEEPTSSFHVGTCFANAQRGTYFDGTGFAKAVGGFKV
GLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAGVPG
HLCDGQWHKVTANKIKHRIELTVDGNQVEAQSLNPASTSADTNDPVFVGGFPDDLKQFGL
TTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
NT seq 9675 nt   +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctcctcctgctgctctccgggggcctcaggggcggt
caggcgcagctgccgcagcagcagcggcggccacaggcacatcagcaaagaggtttattc
cctgctgtcctgaatcttgcttctaatgctcttatcacaaccaatgcaacatgtggagaa
aagggacctgaaatgtactgcaaattggtggaacatgtccctgggcagcctgtgaggaac
ccccagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccgattaca
aatgctattgatggaaagaacacttggtggcagagtcccagtattaagaatggaatcgaa
taccattacgtgacaattacactggatttacagcaggtgttccagattgcatatgtgatt
gtgaaggcagctaactcccctcggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagatacggagtgcctaaccctttac
aatatttatccccgcactgggccaccgtcatatgccaaagacgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
ggaagaccaagtgccgatgatccttctccagaactgctggagtttacctctgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatattactactcggtcaaggat
atttcagttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcaacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctaactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaagtctgagtttgaatatacatggaaagtacattggagggggtgtttgcattaat
tgtacccaaaatactgctggtataaactgtgagacatgtattgatggcttcttcagaccc
aaaggggtatcgccaaattatccaaggccatgccagccatgtcattgcaatccaactggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcaaaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccagactgcaaagcctgtaactgcagtggcttagggagcaaaaatgaggac
ccttgttttggcccctgtaactgcaaggagaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaaggctgcgatgagtgtttctgt
tcaggtgtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgacctttctggccgcattcgagtggctccccagcaggacgac
tcggactcacctcaacagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcaccagctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgacctggaagaagaggaagaagatacagaacatgtt
ctccagtttatgattatcttagagggtaatgacttgagaatcagcacagcccaagatgag
gtgtacctgcacccatctgaagaacatattaatgtattagtacttaaagaagaatcattt
accatacatggcacacattttccagtcagtagaaaggaatttatgacagtacttgcgaat
ttgaagagagtcctcctacaaatcacatacagctttgggatggatgccatcttcaggttg
agctctgttaaccttgaatctgctgtctcctatcctactgatggaagcgttgcagcagct
gtagaagtatgtcagtgcccaccagggtatactggctcctcttgtgaaaagcgacaccaa
gctaatgcttcctctaatctcatacctgccaataacactaagtcttgttggcctaggcac
aggcgagttaacggcaccatttttggtggcatctgtgagccatgtcagtgctttggtcat
gcagagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacacaggcggc
ccatattgtgataaatgtcttcctggtttctatggcgatcctactaaaggaacctctgaa
gactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagcccaacgtgc
catttagaccggagtcttggattgatctgtgatggatgccctgtcgggtacacaggacca
cgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggaggatcatgt
cagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgacagcttg
tctggctcctgtctgatatgtaaaccaggtacaacaggccggtactgtgagctctgtgct
gatggatattttggagacgcagttgatgcaaggaactgtcagccctgtcactgtaatgcc
aatggctctttctctgagatttgccaccgtcaaactggacagtgtgagtgcagagccaac
gtgcagggccagaggtgtgacaaatgcaagcccaatatgtggtgggatccagagaagcga
ttctgtgtgctatgtgactgcgatcccgttggctctgtgtcaccgcaatgtgatattaca
ggaagatgtgtctgtaaaacagacttcgtagggaaacagtgcaacctcggcaggcaggtg
caccaacaggaggagcagccgcagagagcgcaacgggtgctgggttctcctcagaggtgg
gctatcggcagctccagcgggtgccctcggggagcctatcgggccccagctccgcctggg
acctttggtctgcaatcagcaaggggctgtgttccctgcaactgcaattcttttgggtct
aagtcattcgactgtgaagagagtggacaatgttggtgccaacccggagtcacagggaag
aaatgtgaccgctgtgcccatggctatttcaacttccaagaaggaggctgcacagcttgt
gaatgttctcatctgggtaataattgtgacccaaagactgggcgatgcatttgccctccc
aataccattggagagaaatgttctaaatgtgcacccaatacctggggccacagcattacc
actggttgtaagacttgtaactgcagcacagtgggatccttggatttccaatgcaatgta
aatacaggccaatgcaactgtcatccaaaattctctggtgcaaaatgtacagagtgcagt
cgaggtcactggaactaccctcgctgcaatctctgtgactgcttcctccctgggacggat
gccgcaacctgtgattcagagactaaaaaatgctcctgtagtgatcaaactgggcagtgc
acttgtaaggtgaatgtggaaggcatccactgtgacagatgccagcctggcaaattcgga
ctcgatgccaagaatccacttggctgcagcagctgctattgcttcggcactactactcag
tgctctgaagcaaaaggactgatccggacgtgggtaactctgaaggctgagcagaccatt
ctacccctggtagatgaggctctgcagcacacaaccaccaagggcattgcttttcaacat
ccagagattgttgcccacatggacctgatgagagaagatctccgttgggaacctttttat
tggaaacttcctgaacaatttgaaggaaagaagttgatggcctatgggggcaaactcaag
tatgcaatctatttcgaggctcgggaagaaacaggtttttctacatataatcctcaagtg
atcattcgaggtgggacacctactcatgctagaattatcgtcaggcatatggctgctcct
ttgattggccaattgacaaggcatgaaattgaaatgacagagaaagaatggaaatattat
ggggacgatcctcgagtccatagaactgtgacccgagaagacttcttggatatactgtat
gatattcattacattcttatcaaggctacttatggaaatttcatgcgacaaagcaggatt
tctgaaatctcaatggaggtagctgaacaaggacgtagaacagcagtgactcctccagct
cacttgattgaaaaatgtgattgccccctgggctattctggcctgtcctgtgaggcatgc
ttgccaggattttatcgactgcgttctcaaccaggtggccgcacccctggaccaaccttg
ggcacctgtgttccatgtcaatgtaatggacacagcagcctgtgtgaccctgaaacatcg
atatgccagaattgtcaacatcacactgctggtgacttctgtgaacgatgtgctcttgga
tactatggaattgtcaagggattgccaaatgactgtcagcaatgtgcctgccctctgatt
tcttccagtaacaatttcagcccctcttgtgtcacagaaggccttgatgactaccgctgc
acggcttgtccacggggatacgaaggccagtactgtgaaaggtgtgcccctggctatact
ggcagtccaagcagccctggaggctcctgccaagaatgtgagtgtgatccctatggctca
ctgcctgtgccctgtgaccctgtcacaggaatctgcacgtgccgacccggagccacggga
aggaagtgtgacggctgcaagcactggcatgcacgcgagggctgggagtgtgttttttgt
ggagatgagtgcactggccttcttctcggggacttggctcgcctggagcagatggtcatg
agcatcaacctcactggtccgctgcctgcgccatataaaatgctgtatggtcttgaaaat
atgattcaggagctaaagcacctgctctcacctcagcaggccccagagaggcttattcag
ctggcagagggcgatctgaatacactcgtgaccgaaatgaacgagctgctgaccagggct
accaaagtgacagcagatggcgagcagaccggacaggatgctgagaggaccaacacaaga
gcaaagtccctgggagaattcattaaggagcttgcccgggatgcagaagctgtaaatgaa
aaagctataaaactaaatgaaactctaggaactcgagacgaggcctttgagagaaatttg
gaaaggcttcagaaagagattgaccagatgattaaagaactgaggaggagaaatctagag
acacaaaaggaaattgctgaagacgagttggtagctgcagaaggccttctgaaaaaggtg
aaaaagctgtttggagagtcccggggaaaaaatgaagaaatggagaaggatctccgagaa
aaactggcagactacaaaaacaaagttgatgatgcttgggacctgttgagagaagccacg
aataaaatcagagaagctaatcgcttatttgcagtaaaccagaaaaacatgactgcgttg
gagaaaaagaaggaggctgttgaaagtgggaaacgacaaattgagaacactttaaaagag
ggcaatgacatactcgatgaagccaaccgtcttgcagatgaaatcaactccatcatagat
tatgttgaagacatccaaactaaattgccacctatgtctgaggagcttaacaacaaaata
gatgacctctcccaagaaataaaggacaggaagcttgccgagaaggtgtcccaggctgag
agccacgcagctcagttgaatgactcatctgctgtccttgatggaatccttgatgaggct
aaaaacatctccttcaatgccactgcagccttcaaagcttacagcaatattaaggactat
attgatgaagctgagaaagttgccaaagaagccaaagatcttgcacatgaagctacgaaa
ctggcaacaggtcctcggggtttgttaaaggaagatgccaaaggctctcttcagaaaagc
ttcaggattcttaacgaagccaagaagttagcaaatgatgtaaaagaaaatgaagaccat
ctaaatggcttaaaaaccaggatagaaaatgctgatgctagaaatggggatctcttgaga
gctttgaatgacactttgggaaagttatcagctattccaaatgacacagctgctaaactg
caagctgttaaggacaaagccagacaagccaacgacacagctaaagatgtactggcacag
attaaacagctccatcagaacctcgatggcctgaagaagaattacgataaactagcagac
agcgtcgccaaaacgaatgctgtggttaaagatccctccaagaacaaaatcattgccgac
gcagatgccactgtcaaaaatctagaacaggaagctgaccggctaatagataaactcaaa
cccatcaaggaacttgaggataatctaaagaaaaacatctctgagataaaggaattgata
aaccaagctcggaaacaagccaattctatcaaagtatctgtgtcttcgggaggtgactgc
attcgaacatacaagccagaaatcaagaaaggaagttacaataatattgttgtcaatgta
aagacagctgttgctgacaacctcctcttttatcttggaagtgccaaatttattgacttt
ctggctatagaaatgcgtagaggcaaagtcagcttcctctgggatgttggatctggagtt
ggacgtgtagagtacccagatttgactattgatgactcatattggtaccgtatcatggca
tcaagaactgggagaaatggaactatttctgtgagagccctggatggacccaaagccagc
attgtacccagcacataccattcgacgtctcctccagggtacactattctagatgtggat
gcaaatgcaatgctgtttgttggtggcctgactgggaaattaaagaaggctgatgctgta
cgtgtgattacattcaccggctgcatgggagaaacatactttgacaacaaacctataggt
ttgtggaatttccgagaaaaagaaggtgactgcaaaggatgcactgtgagtcctcaggtg
gaagatagtgaggggactattcagtttgatggagaaggttatgcattggtcagccgcccc
attcgctggtaccccaacatctccactgtcatgttcaagttcagaacattttcttcgagt
gctctcctgatgtatcttgccacacgagacctgagagatttcatgagtgtggagctcact
gatgggcacataaaagtcagttatgatctgggttcgggaatggcttccgttgtcggcaat
caaaaccataatgatgggaaatggaaatcattcaccctgtcaagaattcaaaagcacgcc
aacatatcgattgtagatatagatactaatcaggaggagaacatagcaacttcatcttct
ggaaacaactttggtcttgacttgaaagcagatgacaaaatatattttggtggcctgcca
acgctgagaaacttgaggccagaagtaaatctgaagaaatattccggctgcctcaaagat
attgaaatttcaagaacgccgtacaatatcctcagtagtcccgattatgttggtgttacc
aaaggatgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggag
ctctcccctgtgccagttgatgtaggaacagaaatcaacctgtccttcagcaccaagaat
gagtctggcatcattcttttgggaagtggagggacaccagcaccacctaggagaaaacga
aggcagactggacaggcctattatgcaatactcctcaacaggggccgtctggaagtacat
ctctccacaggggcacgaacaatgcggaaaattgtcgtcagaccagagccgaatctgttt
catgatggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaa
gtcgatgaaaacagaagatatatgcaaaacctgacagttgaacagcctcttgaagttaaa
aagcttttcgttgggggtgctccgcctgaatttcaaccttccccactcagaaatattcct
ccttttgaaggctgtgtgtggaatcttgttattaactctgtccccatggactttgcaagg
cctgtatccttcaaaaacgctgacattggtcgctgtgtccatcagaaactccgtgaagat
gaagatggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcc
tttcctacacccaccccagttctgacacatggtccttgtgctgcagaatcagaaccagct
cttttgatagggagcaagcagtttggcctttcaagaaacagtcacattgcaattgcattt
gatgacaccaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaa
tccggcttgcttttttacatggctcgcatcaatcatgctgattttgccacagttcagctg
agaaatggattgccctacttcagctatgacttggggagtggggacaccaacaccatgatc
cccaccaaaatcaatgatggccagtggcacaagattaagataatgagaagtaagcaagaa
ggaattctttatgtagatggggcctccaacagaaccattagtcccagaaaagctgacatc
ctggatgttgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaaga
attggtccagtgacctatagcattgacggctgcatcaggaatctccacatggaagaggcc
cctgctgatctggaagagcccacctccagcttccatgttgggacatgttttgcaaatgct
cagaggggaacatattttgatggaacaggttttgccaaagcagttggtggattcaaagtg
ggattggaccttctcgtagaatttgaattccgcacaactagaacgactggagttcttcta
gggatcagtagtcaaaaaatggatggaatgggtattgaaatgattgatgaaaagctgatg
tttcatgtggacaatggcgccggcagattcactgctatctatgatgctggggttccaggg
catttgtgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgag
ctcacagtcgatgggaaccaggtggaagcccaaagcctaaacccagcatctacatcagct
gacacaaatgaccctgtatttgttggaggcttcccagatgacctcaagcagtttggcctg
accaccagcattccgttccgaggttgcatcagatccctgaagctcaccaaaggcacgggc
aagccactggaagttaattttgccaaggccctggaactgaggggtgttcaacctgtatca
tgcccagccaactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670221
Entry
104670221         CDS       T03989                                 

Gene name
LAMA1
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104670221 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104670221 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670221 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670221 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104670221 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104670221 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104670221 (LAMA1)
   05414 Dilated cardiomyopathy
    104670221 (LAMA1)
   05416 Viral myocarditis
    104670221 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104670221 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104670221 (LAMA1)
   05145 Toxoplasmosis
    104670221 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF1080
Other DBs
NCBI-GeneID: 104670221
NCBI-ProteinID: XP_030782055
LinkDB
Position
21
AA seq 3580 aa
MAGSLLYGCQDTKENTYQARLLHTACDHTLNVAPQACSATNDQNLDCLHAGAGKQSGEQV
ATDFQNKSSSPLPTAERAAGRPSLGGVPRVRLSPSSRQGRVGPGPGTAGPRRGGQGQQGT
YFLGIHPPEPPQPSFSYPQPTFSAHLLSGAWAAAAVSRPPLPGVRVRGIPAAKQGAPGGG
VWAAGPGRAGRGAAGGCVRGRLEGGAAGTPGLRGRGSSDSRPAELFRRTRGFLPRPTERL
RGEMRGGGGAWGVLLASLLWVAARCQQRGEPGPGPWILGSLSPTGGRAGAAADKARRVGA
AGDRARILVHLGLGASDTPASPLAFAELSDPGAPSTRAVLGVAGAGRLGVLSVPRLRGQG
WRGCWPGAGNEWAKSSSESPSLSGCASWVAAVGEGRIPRGHSLPGGLVGRDAARSAPLAS
GPGQGDPQGGVQGTDAPSRPSLFVQSAKWPNPLIPRAGTWRGITLTPTEQSQNLGLGLSA
GWSRFFWKGQSSCKCGMKSHVACNVTVFQEPRKLLALEVPPELMDGLFPAILNLASNADI
STNATCGEKGPEMFCKLVEHVPGRPVRNPQCRICDGSSANPRERHPISHAIDGTNNWWQS
PSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVS
DSECLSRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKL
LEFTSARYIRLRLQRIRTLNADLMTLSHREPKDLDPIVTRRYYYSIKDISVGGMCICYGH
ASSCPWDETTKKLQCQCEHNTCGESCNRCCPGYHQRPWRPGTVSSGNTCEACNCHNKAKD
CYYDESVAKQKKSLNTAGQFRGGGVCTNCLQNTMGINCETCIDGYYRPHKVSPYEDEPCR
PCNCDPVGSLNSVCIKDDLHSDLRNGKGPGQCPCKEGYAGEKCDRCQLGYKDYPACVSCG
CNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFYNLKEKNPQGCSECFCFGVSDVCSSL
SWPVGQVSSMSGWLVTDLISPRRIPSQQDALGGRHQVSINNTAVMQTLAPKYYWAAPEAY
LGNKLTAFGGFLKYTVSYGIPVEAVDSNLMSHADVIIKGNRLTLSTQAEGVSLQPYEEYL
NVIRLVPENFRDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASP
NAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECRGHAAECDVHG
VCIACVHNTTGDHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVV
CDQCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCNSNVDPSEAGHCDSVTGECLKCLG
NTDGAHCERCAEGFYGDAVTAKNCRACGCHAKGSRSAVCHLETGLCNCKPNVTGQQCDQC
LHGYYGLDSGHGCQPCNCSVAGSVSDDCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSC
TPCDCPHTQNTCDPETGECVCPPHTQGVRCEECEDGHWGYDVEMGCQACNCSLVGSTHHQ
CDVVTGRCQCKWKFGGWACDECSLGYRDFPDCVPCDCDLRGTSGDACDLEQGLCGCAEET
GDCPCKENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHVCSELEGYVRTPVTLASD
QPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVWQHIHAEPFYWRLPQQFQGDQLMAYGG
KLKYSVAFYSLDGVGTSNFEPQVLIKGGRTRKQVIYMDAPAPENGVRQEQEVAMRENFWK
YFNSVSEKPVAREDFMSVLSNIEYILIKASYGQGLQQSRISDISMEVGRKAENLHPEEEV
ASLLENCVCPPGTVGFSCQDCAPGYHRGKLPAGSGRGPRPLVAPCVPCSCNNHSDTCDPN
TGKCLNCGDNTAGDHCDVCASGYYGKVTGSASDCALCVCPHSPPASFSPTCVLEGDHDFR
CDACLLGYEGQHCERCSLGYYGNPQTLGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGAS
GLRCDECEPRHILMETDCVSCDDECVGVLLNDLDETGDAILSLNLTGIIPVPYGILSKLE
NTTKYLQESLLRENMQKDLGRIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQ
DLAVAIERLRMNITEIIEKTTLNQTLDEDFLLPNSTLQSMQQNGTSLLEIMQRRDVTQLH
QNATLELKAAEDLLSQIQENYQKPLEELEVLKEAASHLLSKHNSELKAAEVLVREAEAKT
EESNHLLFMVNANLREFSDKKLHVQEEQNLTSELIAQGRGLIDTAAAQTDAVQDALEHLE
HHQDTLLLWSAKVRHHVDDLVMHMSQRNALDLVYRAEDHAAEFQRLADVLDSGLENVRNV
SLNATSAAYVHYNIQNLIEESEELAKDAHRTVTEMSLLSESLVSNGKAAVQRSSRFLNEG
NNLSRKLPVIALELSELRNKTNRFQENADEITRQTNESVLILRAIPEDTRDKGAKTKELA
TSASQSAVSTLRDVAGLSQELLSTSASLSRVNTTLQETHQLLQDSTMATLLAGRKVKDVE
TQANLLFDRLKPLKMLEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQIS
STNYNTLTLNVKTQEPDNLLFYLGSSTSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFP
IDDNRWHSIHAARFGNIGSLSVKEMNSNQKLPAKTSKSPGTANVLDVNNSTLMFVGGLGG
QIKKSPAVKVTHFKGCLGEAFLNGKSIGLWNYIEREGKCHGCFGSSQNEDPSFHFDGSGY
SVVEKSLPATVTQIIMLFNTFSPNGLLLYLGSYGIRDFLSIELFHGRVKVTTDLGSGPLT
LLTDRRYNNGTWYKIAFQRNRKQGVLAVNDAFNTSNKETKQGETPGASSDLNRLDKDPIH
VGGLPRSRVVRRGVTTKSFVGCIKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGG
YIELPPKSLSPESEWLVTFATKNSSGIILAALGGDAEKQGDREESHVPFFSIMLIGGNIE
VHVNPGDGTGLRKALLHAPTGTCSDGQAHSISLVRNRRIITVQLDENNPVEMKLGPLVES
RTINMSNLYVGGIPEGEGTSLLTTRRSFHGCIKDLIFNLGLLDFNSAVGHEQVELDACWL
SERPKPAPDAEDSELLPDPRAFPEQCVVDAALEYVPGAHQFGLSQNSHFLLPFNQSAVRK
RLSVELSIRTFASSGLIYYMAHQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDG
KWHTVKTHYGKRKGFITVDGQESPMVTVVGDGTALDVEGLFYLGGLPSQYRARKIGNITH
SIPACIGDVTVNSKQLDKDSPVSTFTVNRCYAAAQEGTFFDGSGYAALVKEGYKVQTDVN
ITLEFRTSSQNGVLLGISTAKVDAIGLELVDGKVLFHVNNGAGRITATYEPKTATALCDG
KWHTLQANKSKHRITLIVDGNAVGAESPHTRSTSVDTNNPIYVGGYPAGVKQKCLSSQTS
FHGCLRKLALMKRPQVQSFDFSRAFELHGVFLHSCPGTES
NT seq 10743 nt   +upstreamnt  +downstreamnt
atggctggatccctgttatatgggtgtcaggatacaaaggaaaacacttaccaggccagg
cttcttcatacagcctgtgatcacacactgaatgtggctccccaagcctgctcagccacc
aatgaccagaacctggattgtctacatgcaggagcaggcaaacaaagtggggaacaagtt
gcaactgattttcagaacaaatcctcaagtcctctgcccacggcggagagggcagcgggt
cggccgagcctgggtggcgtcccgagggttcgcctctcgcccagctcccggcaggggcgc
gtgggtcctggcccggggactgcagggccgcggcggggcgggcagggtcagcagggcaca
tactttctcggaatccaccctcccgagcccccacagcccagtttctcctaccctcagccc
accttctccgcccacctcctatccggagcctgggcggcggccgcggtcagcagacctccc
ctaccaggggtccgcgtgcgcgggatcccggcggccaagcagggcgccccgggaggaggg
gtctgggcggctgggccaggccgggcggggcggggcgcagccggggggtgtgtccgaggg
cggctggagggaggggctgccgggacaccagggctgcggggccgcggcagctcagactcg
cgtcccgcggagcttttcaggcggacgcgcggctttctccccagacccaccgagcggcta
agaggcgagatgcgcggcggcggcggcgcgtggggcgtgctcctggcctcgctgctgtgg
gtagccgcgcggtgccagcagagaggtgagcccggcccgggtccctggatcctcgggtcc
ctgtcccccacaggcgggcgggcgggggcggccgcggacaaagcccgtcgcgtgggggct
gctggagaccgggcgcgcatcctggtccacctcggactgggggcttctgacactccagcc
tcgcctctggcttttgcggaacttagtgacccaggagcgccatctacgcgagcagtcctg
ggggtggcgggagcggggcgcctgggggtgctttcagtgccccggctgcgcgggcagggg
tggcggggctgctggccgggcgcggggaatgaatgggcaaagagctcctccgaatcaccc
tcattgtccggctgcgcaagctgggtcgccgcggtcggggaagggcggattcctcggggc
cactcgctgccgggcgggctagtggggagagacgcggcgagaagcgcgcccctcgccagc
ggccccgggcagggggacccgcagggcggcgttcagggcactgatgcgccttcccgaccc
tcgctctttgtgcaatcggctaagtggccaaacccgctcattccccgcgcaggcacttgg
agaggtatcacactgacgccaactgagcagagccagaacctgggcctggggctgtctgca
gggtggagcaggttcttctggaagggccagtccagctgcaagtgtgggatgaagtctcat
gtagcctgtaatgtaacagttttccaagagcccagaaagctgttggcattggaagttccc
cctgagttaatggacggcctgtttcctgccattctcaatcttgccagcaacgctgacatc
agtaccaatgccacctgtggcgagaaggggcccgagatgttctgcaaacttgtggagcat
gtgccgggtcggcccgtccgaaacccacagtgccggatctgtgatggcagcagtgcaaac
cccagagaacgccatccaatatcacatgccatagatggcaccaataactggtggcaaagt
cccagcattcagaatgggagagagtatcactgggtcacaatcactctggacttaaggcag
gtctttcaagttgcatatgtcatcattaaagctgccaatgcccctcggcccggaaactgg
attttggagcgttctctagatggcaccacgttcagcccctggcagtattatgcagtcagc
gactcagagtgtttgtctcgttacaatataactccaagacgagggccgcccacctacagg
gctgatgatgaagtgatctgcacctcctattattccagattggtgccacttgagcatgga
gagattcatacatcactcatcaatggcagaccaagcgctgacgatctttcacccaagttg
ttggaattcacttctgcacgatatattcgccttcgcttacaacgcattagaacgctcaat
gcagatctcatgactcttagccaccgggaacctaaagacctggatcctattgttaccaga
cgctattattattcaataaaggacatttctgttggaggcatgtgtatctgctatggccat
gctagtagctgtccatgggatgaaactacaaagaaactgcagtgtcagtgtgagcataat
acttgcggggagagctgtaacaggtgctgtcctgggtaccatcagcggccctggaggcct
ggaaccgtgtcctctggcaatacatgtgaagcatgtaattgtcacaataaagccaaagac
tgttactatgatgaaagtgttgcgaagcagaagaaaagtttgaatactgctggacagttc
agaggaggaggggtttgcacaaactgcttgcagaacaccatgggaattaactgtgagacc
tgtattgatggatattacagaccacacaaagtgtctccttatgaggatgagccttgccgc
ccctgcaactgtgaccctgtggggtccctcaattctgtctgtattaaggatgaccttcat
tctgacttacgcaatgggaaggggccgggtcagtgcccgtgtaaggaaggctatgcagga
gaaaaatgtgatcgctgccaacttggctataaggattacccggcctgtgtctcctgtggg
tgcaacccagtgggcagtgccagtgacgagccctgcacagggccctgtgtttgtaaggaa
aatgtggaggggaaagcctgcgatcgctgcaagccaggattctataacctgaaagaaaaa
aacccccagggctgctccgagtgcttctgctttggcgtttccgatgtctgcagcagcctc
tcttggcctgttggtcaggtaagcagtatgtccgggtggctggtcaccgacctgatcagt
cccaggaggattccgtctcagcaagatgcactgggcgggcgccaccaggtcagcatcaac
aacaccgcggtcatgcagacgctggctcccaagtactactgggcggcccccgaggcctac
cttggaaataagctgactgcatttggtggattcctgaaatacacagtgtcttatggcatc
ccagtagaggcggtagacagtaacctcatgtcgcacgctgacgtcatcattaagggaaac
agactcactttaagcacacaggctgagggtgtgtcattgcagccttatgaagagtaccta
aatgtgattagacttgtgcctgaaaacttccgagattttcacagcaaaaggcagatcgat
cgtgaccagctgatgactgtccttgccaatgtgacacatcttttgatcagagccaactac
aattctgcaaaaatggctctttacaggttggagtccgtctctctggacatagccagccct
aatgccatcgacctggtggtggccgctgatgtggagcactgtgaatgtccgcaaggctac
acagggacctcctgtgagtcgtgcctctctggctattaccgcgtggatggaatactattc
ggaggaatttgtcagccctgcgaatgccgcggccatgcagctgagtgcgatgttcacggc
gtttgcattgcatgtgtgcacaacaccaccggtgaccactgtgaacagtgcttacctggc
ttctacggggagccttcccgagggactcccggggactgccagccctgcgcctgccctctc
accatagcctccaacaatttcagccccacctgccacctcaatgatggggatgaggtggtc
tgcgaccagtgtgccccaggatactcaggagcttggtgtgagagatgtgcagatggttac
tatggaaacccaacagtgcctggcgaatcttgtgttccctgtgactgcaacagcaatgtg
gacccctcggaggctggtcactgtgactcggtcaccggggagtgcctgaagtgcctgggg
aacacagacggcgcccactgtgaaaggtgtgctgaaggtttctacggggacgctgtgaca
gccaagaactgccgcgcctgcggatgccatgcgaaaggctcccgttctgccgtgtgccat
cttgagaccggactctgcaactgcaaaccaaacgtgactggacagcagtgtgaccagtgt
ttgcatggctattatgggctagactcgggccatggctgccagccctgcaattgcagcgtg
gcaggctccgtgtcagatgactgcacagatgaaggccagtgtcactgcgtcccgggtgtg
gcagggaaaaggtgtgacaggtgtgcccatggcttctatgcctaccaggatggcagctgt
acaccctgtgactgcccacacactcagaatacctgcgacccagaaactggagagtgtgtc
tgcccccctcacacacagggtgtgaggtgtgaagaatgtgaggatgggcactggggctac
gatgtggagatggggtgccaggcctgcaactgcagtctcgtggggtcgactcatcatcag
tgtgacgtggtcaccggccgttgccagtgcaagtggaaatttggtggctgggcctgtgat
gagtgctccttgggttacagagactttcccgactgtgttccctgtgactgtgacctgagg
gggacatcgggggatgcctgcgacctggagcagggtctctgcggctgtgcagaggaaacc
ggggactgcccttgcaaggagaatgtctttggccctcagtgcaacgagtgtcgagagggc
acctttgccctccgcgcggacaaccccctgggctgcagcccctgcttctgctctgggctg
tcccacgtctgctcagagctggagggctacgtgaggaccccagtaacgctggcctccgat
cagcctcttctgcgtgtggtttctcagagtaacctgaggggcacgactgagggggtttac
taccaggcccccgacttcctactggatgccgccaccgtctggcagcacatccatgcagag
ccgttttactggcggctgccgcagcagttccagggagaccagctcatggcctatggtggc
aaactgaagtacagcgtggccttctattctttggacggcgtcggcacctccaattttgag
cctcaagttctcatcaaaggtggtcggaccagaaagcaagtcatttacatggatgcacca
gccccagagaatggagtgaggcaggaacaagaagtagcaatgagagagaatttttggaaa
tattttaactctgtttcggaaaaacctgtcgcgcgagaggattttatgtctgtccttagc
aatattgagtacatcctcatcaaggcatcatatggtcaaggattacagcagagcagaatc
tcagacatttcaatggaggttggcagaaaggccgaaaacctgcacccagaagaagaggtt
gcatctcttttagagaattgtgtctgtcctcctggcactgtgggattctcatgtcaggac
tgtgctcctgggtaccacagagggaagctcccagcagggagtggcaggggaccgcgccct
ctggttgctccttgtgtgccctgcagctgcaacaaccatagtgacacctgtgaccccaac
accgggaagtgtctgaactgcggcgataacacagcaggtgaccattgcgatgtgtgtgct
tctggctactatgggaaggtgactggctcagcaagtgactgtgctctgtgtgtctgtcct
cacagcccccctgccagttttagtcccacttgtgtcttggaaggtgaccacgatttccgt
tgtgatgcctgtctcctgggctatgaaggacaacattgtgaaaggtgctccttgggctat
tatgggaaccctcaaacactaggtggcagttgccagaagtgtgactgcaaccctcacggc
tctgtccatggcgactgtgaccgcacatctgggcagtgtgtttgcaggctgggggcctcg
gggctccggtgcgatgagtgtgaaccgaggcacattctgatggaaacagattgtgtttcc
tgtgatgatgaatgtgtaggtgtgctgctgaatgacttggatgagactggtgatgccatt
ctttctctgaacctcactggcattatccctgtcccatatggaattttgtcaaagctggaa
aatacaactaaatatctccaggaatctttattaagagaaaatatgcaaaaggacctggga
agaattaagcttgaaggtgttgcagaagaaacggataacctgcaaaagaagctcactaga
atgttagcaagtacccaaaaggtgaatagggcaactgagagaatcttcaaggagagtcaa
gacctggccgtagccattgagaggttgcggatgaacatcacagaaattattgaaaagaca
actttaaatcagactttggatgaagatttcctgctacccaattctacgcttcagagcatg
caacaaaatgggacatctttgctggaaatcatgcagagaagagacgtcacacagttgcac
caaaatgccacccttgaactcaaggctgctgaagatttattgtcacaaattcaggaaaat
taccaaaagccgctggaagaattggaggtattgaaagaagcagcaagccacctcctttca
aagcacaacagtgaactaaaggcagctgaggtgcttgtgagggaagccgaggcaaagacc
gaggaaagcaaccacctgctgttcatggtcaatgctaacctgagagaattcagtgataaa
aagctacatgttcaagaagaacaaaatctgacctcagagctcattgcccaaggaagagga
ctgatagatactgctgctgcacaaacagacgctgtacaagatgctctagagcacttagag
catcaccaggatacgctacttttatggtctgccaaagtcaggcaccacgtagatgacctg
gtcatgcacatgtcccaaaggaacgcacttgacctggtctacagagctgaggaccatgcc
gctgagttccagagactagcagatgttctggacagtggccttgaaaatgtcagaaatgtg
tccctgaatgccaccagtgcagcctatgtccattacaacatccagaacctgatcgaagaa
tcggaggaactggccaaagatgctcacaggactgtgactgagatgagcctgctctcagaa
tcccttgtttctaatgggaaagcggccgtgcagcgcagctccagatttctaaatgaaggc
aacaacctcagcaggaagcttccagttattgcattggaactgagtgagctgagaaataag
acaaacagatttcaagagaatgccgatgaaattacccggcagaccaatgaatcagtcttg
atactcagagcaattcctgaagatacaagagacaaaggagccaaaaccaaagagctagcg
acgtctgcaagccagagcgcggtgagcacgctgagggacgtggcagggctgagccaggag
ctgctgagcacatctgccagcctgtccagggtcaacaccacattacaagagacgcaccag
cttctgcaggactccaccatggccactctgttggctggaagaaaagtcaaagacgtggaa
actcaagccaaccttttgtttgatcggttgaagcctttgaagatgttagaagagaatctg
agcagaaacctatcagaaattaaactgctcatcagccaggcccggaaacaagcggcttct
attaaagtcgctgtgtctgcagacagagattgcatccgggcctaccagcctcagatttcc
tctactaactacaacaccttaacactaaatgttaagacacaggaacccgataatcttctc
ttctacctcggtagcagcacctcttctgatttccttgcagtggagatgcggcgagggaaa
gtggccttcctgtgggacctgggctccgggtccacacgcttggagtttccagactttccc
attgatgacaacagatggcacagtatccatgccgccagatttggaaacattggttcactg
agtgtaaaggaaatgaactcaaatcaaaagctaccagcaaaaacaagtaaatcccctggg
acagctaatgttctggatgtaaacaattcaacactcatgtttgttggaggtcttggagga
caaatcaagaaatctcctgctgtgaaggttactcattttaaaggctgcttgggagaagcc
ttcctgaatggaaaatccattggcctatggaactatattgaaagggaaggcaagtgtcat
gggtgcttcggaagctcccagaatgaagacccttccttccattttgacgggagtgggtac
tctgtcgtggagaagtcacttccggctaccgtgactcagataatcatgctttttaatacc
ttttcacctaatggacttcttctctacctgggttcatacggcataagagactttttatcc
atcgagctgttccatggcagagtgaaggttacgactgacctgggttcaggaccacttacc
cttttgacagatagacgttataacaatggaacctggtacaaaattgccttccagcgaaac
cggaagcaaggagtcctagcagttaacgatgcctttaacaccagtaataaagaaaccaag
cagggcgagactccgggagcatcttccgacctcaaccgtctagacaaggatccgattcat
gtgggtggattgccaaggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtg
ggctgcatcaagaacctggaaatatccagatcaacctttgacttactcagaaattcctac
ggagtgagaaaaggctgcttactggagcccatccggagcgttagcttcttgaaaggcggc
tacattgaattgccacccaagtctttgtcaccagaatcggaatggctggtaacatttgcc
accaagaacagcagtggcatcatcctggctgccctcggtggggatgcagagaagcagggt
gatcgtgaggagtcacacgtgcccttcttttccatcatgctgattggaggcaacattgag
gtacatgtcaatcctggggatggcacaggcctgaggaaagctctcctgcacgctcccacg
ggtacatgcagcgatggacaagcacattccatctccttggtcaggaatcggagaattatc
actgtccagttggatgagaacaatcctgtggaaatgaagttgggcccattagtagaaagc
aggacgataaatatgtccaatctgtacgtcgggggaattccagagggagaggggacatca
ctgcttacaacgagaagatcgttccatggttgtatcaaagacctgatctttaatttggga
cttttggatttcaacagtgcagttggccatgagcaagttgaattggacgcctgctggctg
tcagaaaggcctaagccggctcccgatgcagaggacagcgagctcttgccagacccccgg
gcttttccagaacagtgtgtggtggatgcagctctggagtacgttcctggcgcccaccag
tttggtctctcacaaaacagccattttctgttgccttttaatcagtcggctgtcagaaag
aggctctcggttgagctaagtatccgcacgttcgcctccagcggcctgatttactacatg
gctcatcagaaccaagcagactacgctgtgctccagctgcacgggggccgcctccacttc
atgtttgaccttggcaaaggcagaacaaaggtctctcaccctgcactgctcagcgatggc
aagtggcacacggtcaagacacattatggtaaaagaaaaggcttcatcacggtggacggc
caagagtcccccatggtgactgtggtgggagacggaaccgcgctggatgtggagggcttg
ttctacctaggaggcctgccctcccagtaccgggccaggaaaattggaaatatcacccac
agcatccctgcctgcattggggatgtgacggttaacagcaaacagctggacaaggacagc
ccagtgtccaccttcacagtgaacaggtgctacgcagcggcccaggaaggaacattcttt
gatggaagcggatacgcagctcttgtcaaagagggctacaaagtccagacggatgtgaac
atcacactggaatttcgaacctcctcgcagaatggcgtcctcctggggatcagcactgcc
aaagtggatgccattggactagagcttgtggatggcaaggtcttgttccatgtcaacaat
ggtgctggcaggataacagccacatatgagcccaaaaccgccactgcgctctgtgatgga
aaatggcacacgcttcaagctaacaaaagcaaacaccgtatcactctgattgtcgatggg
aacgcagttggcgctgaaagtccacacacccgctctacctcggtggacaccaacaatccc
atttatgttggtggctatcctgctggcgtgaagcaaaaatgcctgagcagccagacctcg
ttccacgggtgtttgaggaagctagcgctgatgaagaggccgcaggtgcaatcctttgac
ttcagcagagcgtttgaactgcacggagttttccttcattcctgtcctgggacggagtcc
tga

DBGET integrated database retrieval system