KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655327
Entry
104655327         CDS       T03989                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1 isoform X2
  KO
K04705  signal transducing adaptor molecule
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104655327 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104655327 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104655327 (STAM)
Membrane trafficking [BR:rro04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    104655327 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 104655327
NCBI-ProteinID: XP_010353051
UniProt: A0A2K6Q9U6
LinkDB
Position
11
AA seq 540 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVAFPAIGSQAAEQAKASPALAAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPTATVAAATADVTLYQNAGPSMSQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgagaagagtgaaccacaaagatcctcac
gttgctatgcaggctttgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgacccacagcttagtctaatatcagcaatgattaagaatcttaaggagcaaggagtt
gcgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctcttgca
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtctctcaaggaacaaaggcagcagtcaaccacgctttccactttgtatccaagc
acatccaacctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tctaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagagacaatagaaccagagccggaaccagcc
tttattgatgaagataaaatggaccagttgctacagatgttgcaaagtacagaccccagt
gacgatcagccagacctcccagaactacttcatcttgaagcaatgtgtcaccagatgggc
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggcactttccttatataccaagttaatgaacgaagatccgatg
tattccatgtatgcaaagttacagaatcagccgtattatatgcagtcgtctggtgtttct
ggttctcaggtgtatgcagggcctcctccaagtggtgcctacctggttgcagggaatgcg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtcgtcccgccgtccgcaaacccagcccttcctagtcagcagactcaggctgcttac
cccaatacaatggtgagttccgttcaaggaaacacgtatcccagccaggcgccggtatat
agtcctcctcctaccgctactgttgctgcagcaactgccgatgtcactctgtaccagaat
gcaggacctagtatgtcccaggtgccaaactataacttaacctcatcaaccctgcctcag
cctggaggcagccaacagccacctcagccacagcaaccgtattctcagaaggctctgcta
tag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669802
Entry
104669802         CDS       T03989                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adapter molecule 2 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104669802 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104669802 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104669802 (STAM2)
Membrane trafficking [BR:rro04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    104669802 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH
Other DBs
NCBI-GeneID: 104669802
NCBI-ProteinID: XP_010371203
UniProt: A0A2K6P9Z2
LinkDB
Position
14
AA seq 525 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNVETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPPNVNSSVTTQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQ
MGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcctttgttcaccgccaaccccttcgagcaagacgtggaaaaagccacaaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagtactcct
aatggagcgaaagattgcctaaaagccataatgaaaagggtaaatcataaggttccacat
gttgctctgcaggcactaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagttcgtgctgtgattaaaaataag
gcacatcctaaagtatgtgaaaaactgaaatctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaggaagga
attacttttcctccagcaggttctcagactgtctctgctgctgccaagaatggtacgtca
tcgaacaaaaacaaagaggatgaagacatagctaaagctattgaattatcgctgcaagaa
cagaaacaacaacacacagaaacaaaatccttatatccatctgcagaaattcagttaaat
aataaggttgcacggaaagtgagagctttatatgattttgaagctgttgaggacaatgaa
ctcacctttaaacatggtgaaataattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggacttttcccatccaattttgtaacaactaattta
aacgtagagactgaggcagcggctgtggacaaattgaatgtaattgatgatgatgtggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtacttcagagtatagatccaacagattcaaaaccagactcccaagaccttttg
gatttagaagatatctgccaacagatgggtccaatgatagatgaaaaactcgaagaaatt
gataggaagcattcagaattgtctgaattgaatgtaaaagtcctggaagctctggaacta
tataacaaattggtgaatgaagcaccagtgtactcagtctattcaaagctccaccctcca
gcacattacccacctgcatcatccggggttccaatgcagacatatccagttcaatcacat
ggtggaaactatatgggtcagagcattcaccaagtaactgttgcccaaagctatagccta
ggacccgatcagattggtccactgagatctctgcctccaaatgtgaattcctcagtgaca
acacagcctgctcaaacttcatatttaagcactggacaagacactgtttccaatcctact
tatatgaaccagaactctaacctacagtcagctactggtacaactgcttacacacagcaa
atggggatgtctgtggatatgtcatcttatcagaacactacttccaatttacctcaactg
gcaggctttccggtgacagttccagctcatccagttgcacagcagcacacaaattaccat
cagcagcctctcctttag

DBGET integrated database retrieval system