KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655400
Entry
104655400         CDS       T03989                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5
  KO
K06588  integrin beta 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05205  Proteoglycans in cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104655400 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104655400 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104655400 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655400 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104655400 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104655400 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104655400 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104655400 (ITGB5)
   05414 Dilated cardiomyopathy
    104655400 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104655400 (ITGB5)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    104655400 (ITGB5)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104655400 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1 DUF2975
Other DBs
NCBI-GeneID: 104655400
NCBI-ProteinID: XP_010353119
UniProt: A0A2K6PYE3
LinkDB
Position
1
AA seq 799 aa
MPRAPAPLYACLLGLCALLPGLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVRNGCGGEIESPASSFHILRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKATFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSVEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCMCGCSVGLEPNSARCSGSG
TYVCGLCECSLGYLGTRCECQDGENHSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGKDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYAELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgtctcctggggctctgcgcgctcctgccc
gggcttgcaggtctcaacatatgcactagtggaagtgctacttcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgacttgagggcaaaccttgtcagaaatggctgtggaggtgagatagag
agcccagccagcagcttccatatcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcgggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaaggccaccttccagctacaggttcgccaggtagaggactatcctgtggacttg
tactacctgatggacctctccctgtccatgaaggatgacttggacactatccggaacctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgtcgataaggacatctctcctttctcctacacggcaccgaggtaccagactaat
ccatgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctc
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacggatgatgtg
ccccacatcgcattggatggaaaattgggaggcctggtgcagccacatgatggccagtgc
cacctgaatgaggccaatgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaactggcagagaacaacatcaacctcatctttgcggtgacaaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaacagtatccggtct
aaagtggagctgtcagtctgggatcagcctgaagatcttaatctcttctttactgctacc
tgccaagatggggtatcctaccctggtcagaggaagtgtgagggcctgaagattggggac
acggcatcttttgaggtgtcagtggaggcccgaagctgccccagcagacacacagagcac
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcatgtgtggctgcagcgtggggctggaacccaacagcgccaggtgcagcgggagcggg
acctatgtctgcggcctgtgtgagtgcagcctcggctacctgggcaccaggtgtgagtgc
caggatggggagaaccacagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgcggggagtgcagctgcaaccagtgctcctgcttcgagagtgagttc
gggaagatctatgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccacggtgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggagacaactgtaactgctcgacagacatcagcacatgccggggcaaagatggccag
atctgcagcgagcgcgggcactgtctctgtgggcagtgccagtgcacagagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcgtgcagcaccaagagagat
tgtgttgagtgcctgctgctccactccgggaaacctgacaaccagacctgccacagcctg
tgcagggacgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctttgtttctacaaaaccgccaaggactgcgtcatgatgttcacctacgcggagctcccc
agtgggaagtccaacctgacggtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggcagcatcctcctggttgggctcgcactcctggct
atctggaagctgctcgtcaccatccacgaccggagggagtttgcaaagttccagagcgag
cgatccagggcccgctatgaaatggcttcaaacccattgtacagaaagcctatctccacg
cacactgtggacttcaccttcaacaagttcaacaaatcctacaatggcactgtggactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658643
Entry
104658643         CDS       T03989                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8
  KO
K06591  integrin beta 8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104658643 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104658643 (ITGB8)
   04514 Cell adhesion molecules
    104658643 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104658643 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104658643 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104658643 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104658643 (ITGB8)
   05414 Dilated cardiomyopathy
    104658643 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104658643 (ITGB8)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104658643 (ITGB8)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104658643 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Other DBs
NCBI-GeneID: 104658643
NCBI-ProteinID: XP_010357012
UniProt: A0A2K6N921
LinkDB
Position
6
AA seq 769 aa
MCGSALAFFTAAFVCLQNDRRGPASFLWAACVLSLVLGLGQGEDNICASSNAASCARCLA
LGPECGWCVQEDFISDGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVHVENQVQGVYFNITAICPDGSRKPGMEGCR
NVTSNHEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCHTACKENWNCVQCLHPHNLSQAILDQCKTS
CALVEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
EYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtgtggctcggccctggctttttttaccgctgcatttgtctgcctgcaaaacgaccgg
cgaggtcccgcctcgttcctctgggcagcctgtgtgctttcacttgttcttggactgggc
caaggtgaagacaatatatgtgcatcttcaaatgcggcatcctgtgccaggtgccttgcg
ctgggtccagaatgtggatggtgtgttcaagaggatttcatttcagatggatcaagaagt
gaacgttgtgatattgtttccaatttaataagcaaaggctgctcagttgattcaatagaa
tacccatctgtgcatgttatcatacccactgaaaatgaaattaatacccaggtgacacca
ggagaagtgtctatccaactgcgtccaggagctgaagctaattttatgctgaaaattcat
cctctgaagaaatatcctgtggatctttattatctggttgatgtctcagcatcaatgcac
aataatatagaaaaattaaattccgttggcaacgatttatctagaaaaatggcatttttc
tcccgtgactttcgccttggatttggttcatacgttgataaaacagtttcgccatacatt
agcatccaccccgaaaggattcataatcaatgcagtgactacaatttagactgcatgcct
ccccatggatacatccatgtgctgtctttgacagagaacatcactgagtttgagaaagca
gttcacagacagaagatctctggaaacatagatacaccagaaggaggttttgacgccatg
cttcaggcagctgtctgtgaaagtcatattggatggcgaaaagaggctaaaagattgctg
ctggtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggcatagtg
gtgcccaatgatggaaactgccatctgaaaaacaacgtctacgtcaaatcgacaaccatg
gaacatccctcactaggccaactttcagagaaattaatagacaacaacattaatgtcatc
tttgcagttcaaggaaaacaatttcattggtataaggatcttctacccctcttgccgggc
accattgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtggaagcc
tatcagaagctcatttcagaagtgaaagttcatgtggaaaaccaggtacaaggtgtctat
tttaacattaccgccatctgtccagatgggtccagaaagccaggcatggagggatgcaga
aacgtgacaagcaatcatgaagttcttttcaatgtaacagttacaatgaaaaaatgtgat
gtcacaggaggaaaaaactatgcaataatcaaacctattggttttaatgaaaccgctaaa
attcatatacacagaaactgcagctgtcagtgtgaggacaacagaggacctaaaggaaag
tgtgtagatgaaacttttctagattccaagtgtttccagtgtgatgagaataaatgtcat
tttgatgaagatcagttttcttctgagagttgcaagtcacacaaggatcaacctgtttgc
agtggtcgaggagtttgtgtttgtgggaaatgttcatgtcacaaaattaagcttggaaaa
gtgtatggaaaatactgtgaaaaggatgacttttcttgtccatatcaccatggaaatctg
tgtgctgggcatggagagtgtgaagcaggcagatgccaatgcttcagtggctgggaggga
gatcggtgccagtgcccttcagcagcagcccagcactgtgtcaattcaaagggccaagtg
tgcagtggaagaggcacgtgtgtgtgtggaaggtgtgagtgcaccgatcccaggagcatc
ggccgcttctgtgaacactgccccacctgtcatacggcctgcaaggaaaactggaattgt
gtgcaatgccttcaccctcacaatttgtctcaggctatacttgatcagtgcaaaacctca
tgtgctctcgtggaacaacagcattatgtcgaccaaacttcagagtgtttctctagccca
agctacttgagaatatttttcatcattttcatagttacattcttgattgggttgcttaaa
gtccttatcattagacaggtgatactacaatggaatagtaacaaaattaagtcctcgtca
gagtacagagtgtcagcctcaaaaaaggataagttgattctgcaaagtgtttgcacaaga
gcagtcacctacagacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaat
gctcatgaaactttcaggtgcaacttctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662513
Entry
104662513         CDS       T03989                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3 isoform X1
  KO
K06493  integrin beta 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04611  Platelet activation
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro04919  Thyroid hormone signaling pathway
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05168  Herpes simplex virus 1 infection
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104662513 (ITGB3)
   04151 PI3K-Akt signaling pathway
    104662513 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104662513 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104662513 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104662513 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104662513 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104662513 (ITGB3)
   04611 Platelet activation
    104662513 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104662513 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104662513 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104662513 (ITGB3)
   05205 Proteoglycans in cancer
    104662513 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104662513 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    104662513 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104662513 (ITGB3)
   05414 Dilated cardiomyopathy
    104662513 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104662513 (ITGB3)
   05163 Human cytomegalovirus infection
    104662513 (ITGB3)
   05165 Human papillomavirus infection
    104662513 (ITGB3)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    104662513 (ITGB3)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104662513 (ITGB3)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104662513 (ITGB3)
CD molecules [BR:rro04090]
 Proteins
  104662513 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 104662513
NCBI-ProteinID: XP_010361827
UniProt: A0A2K6Q2S9
LinkDB
Position
19
AA seq 788 aa
MRAQPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLSLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSRHCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgcgagcgcagccgcggccccggccgctctgggcaactgtgctggcgctgggggcgctg
gcgggcgttggcgtcggagggcccaacatctgtaccacgcgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccggaatccatc
gagttcccagtcagtgaggcccgagtactagaggacaggcccctcagcgacaaaggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggacgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggcccttgaa
aacccctgctatgatatgaagaccacgtgcttgcccatgtttggctacaaacacgtgctg
tcgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcatcgcacttgctggtgtttaccactgatgccaagact
catatagcactggacggaaggctggcaggcattgtccagcccaatgatgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctctcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagtcggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgctctaaa
gtcgagctggaagtgcgtgacctccctgaagaattgtctctatccttcaacgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgcccccaggagaaggagaagtccttt
accatcaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgcgac
tgtgcctgccaggcccaagctgaacctaatagccgtcactgtaacaatggcaatgggacc
tttgagtgtggggtgtgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggatgagtgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgtctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgtaccacacgtactgatacctgcatgtccagcaatgggcttctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccaggctcctat
ggggacacctgtgagaagtgccctacctgcccagatgcctgcacctttaagaaagaatgc
gtggagtgtaagaagtttgaccggggagccctacatgatgaaaatacctgcaaccgttac
tgccgcgatgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgattgtgtcgtcagattccagtactatgaagactctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctgtcagtgatgggggccattctgctcattggccttgccactctgctcatc
tggaagctcctcatcaccatccacgaccgaaaagagtttgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtcaaccttc
accaatatcacctaccggggcacttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663301
Entry
104663301         CDS       T03989                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04530  Tight junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro05100  Bacterial invasion of epithelial cells
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05145  Toxoplasmosis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104663301 (ITGB1)
   04151 PI3K-Akt signaling pathway
    104663301 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104663301 (ITGB1)
   04514 Cell adhesion molecules
    104663301 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104663301 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104663301 (ITGB1)
   04530 Tight junction
    104663301 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104663301 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104663301 (ITGB1)
   04670 Leukocyte transendothelial migration
    104663301 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    104663301 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663301 (ITGB1)
   05205 Proteoglycans in cancer
    104663301 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104663301 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663301 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104663301 (ITGB1)
   05414 Dilated cardiomyopathy
    104663301 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104663301 (ITGB1)
   05133 Pertussis
    104663301 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    104663301 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104663301 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104663301 (ITGB1)
   05140 Leishmaniasis
    104663301 (ITGB1)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    104663301 (ITGB1)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104663301 (ITGB1)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104663301 (ITGB1)
CD molecules [BR:rro04090]
 Proteins
  104663301 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 104663301
NCBI-ProteinID: XP_010362739
UniProt: A0A2K6RRF7
LinkDB
Position
11
AA seq 801 aa
MNLQLIFWIGLISSICCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKAGL
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgatcagttccatttgctgtgtgtttggt
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcccact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttagag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttccgacttc
agaattggatttggttcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtctcactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaataatatgtatacaatgagtcattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggagtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aacgggacgtttgagtgtggcgcgtgcaggtgcaacgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggacgcttactgcagaaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtttgtggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcgtgtgactgttctttggatactagtacttgcgaa
gccagcaacggacagatctgtaatggccggggcatctgcgaatgtggtgtctgtaagtgt
acagatccgaagttccaagggcaaacatgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcgcacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccagtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacatattcagtgaatgggaacaatgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgattattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgcaagaaaat
ccgatttacaagagtcctattaataatttcaagaatccaaactacggacgtaaagctggt
ctctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670606
Entry
104670606         CDS       T03989                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7 isoform X1
  KO
K06590  integrin beta 7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04672  Intestinal immune network for IgA production
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05202  Transcriptional misregulation in cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104670606 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104670606 (ITGB7)
   04514 Cell adhesion molecules
    104670606 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670606 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104670606 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    104670606 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104670606 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104670606 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104670606 (ITGB7)
   05414 Dilated cardiomyopathy
    104670606 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104670606 (ITGB7)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104670606 (ITGB7)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104670606 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 104670606
NCBI-ProteinID: XP_010372240
UniProt: A0A2K6NX50
LinkDB
Position
10
AA seq 798 aa
MVALPVVLVLLLVLSRGESELDAKIPSTGEATEWGNPHLSLLGSCQPAPSCQKCIVSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSHGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGIHISYESQCEGPEKKEG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQAQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSEAELSSLDLESGCRAPNGTGPLCSGK
GQCQCGHCSCNGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECEAFGTG
PLATNCSTACAHTNVTLVLAPILDDGWCKERTLDNQLFFFLVEDDARGRVVLRVRPQEKG
ADHTQAIVLGCIGGIVVVGLGLVLAYRLSVEIYDRREYSRFEKERQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggtggctttgccagtggtccttgttttgctgctggtcctgagcagaggtgagagtgag
ttggacgccaagatcccatccacaggggaggccacagaatgggggaatcctcacctgtcc
ctgctggggtcctgccagccagccccctcctgccagaagtgcatcgtctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggggaggcggaggcacggcgctgt
gcccgacgagaggaactgctggctcgaggctgcccgctggaggagttggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccacggcgcccgcggagagggtgcc
actcagctggcgccgcagcgggtccgggtcacgctacggcctggagagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagcttgggcatgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtgccctccaagctgcgccacccctgccccacacggctg
gagcgctgccagtcacccttcagctttcaccatgtgctgtccctgaccggggatgcgcaa
gcctttgagcgggaggtggggcgccagagcgtgtccggcaatctggactcacctgaaggt
ggctttgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagatgacacattccatacggctggggacgggaagttg
ggtggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcaccgagtttgactacccctctgtgggtcaggtagcccaggccctctctgcagca
aacatccagcccatctttgctgtcaccagtgctgcactgcctgtctaccaggagctgagt
aagctgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataacagcctgtcttccactgtgacccttgaacactcttcactc
cctcctgggatccacatttcttatgaatcccagtgtgagggtcctgagaagaaggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacactgtgtgactgtaactgcagtgac
acccaggcccaggctccccactgcagtgatggccagggacacctacaatgtggggtatgc
agctgtgcccccggccgcctaggccggctctgtgagtgctctgaggctgagttgtcctcc
ctagatctggaatctgggtgccgggctcccaatggcacagggcccctatgcagcggaaag
ggtcagtgccaatgtggacactgcagctgcaatggacagagctctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgtggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggatggctactacggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtgaggcctttgggactggc
cccctggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggtgttggcc
cctatcttggatgatggctggtgcaaagagaggaccctggacaaccagttgttcttcttc
ttggtggaggatgacgccagaggcagggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacccaggccattgtgctgggctgcatagggggcatcgtggtagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcggcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674711
Entry
104674711         CDS       T03989                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 isoform X1
  KO
K06589  integrin beta 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104674711 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104674711 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674711 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104674711 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104674711 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104674711 (ITGB6)
   05414 Dilated cardiomyopathy
    104674711 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104674711 (ITGB6)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   104674711 (ITGB6)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104674711 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 104674711
NCBI-ProteinID: XP_010377408
UniProt: A0A2K6RPN7
LinkDB
Position
14
AA seq 788 aa
MGIELLCLFFLFLGRNDHAQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTFFQHQKKCSHMKVGDTASFNVT
VNIPNCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCISEDGVLCSGRGDCVCG
KCVCANPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKSIIHSISEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDG
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctgtttctaggaaggaatgatcacgcacaa
ggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgctcattggacctcag
tgtgcctggtgtgctcaggagaattttacccatccatctggagttggtgaaaggtgtgat
accccagcaaatcttttagctaaaggatgccaattaaacttcatcgaaaaccctgtctcc
caagtagaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcacctcaaagcttgatccttaagttgagaccaggtggtgcacagact
ctgcaggtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggac
ctctctgcctccatggatgatgacctcaacacaatcaaggagttgggctcccggctttcc
aaagagatgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaa
cctgtatccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgtttacctacatttggattcaagcacattttgccattgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatatcgacacacccgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggttggcggaat
gactccctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactggcaggcatcgtcattcctaatgacgggctctgtcacttggatagcaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggta
caaaacaacgtgttattgatcttcgctgtaacccaagaacaagttcatttatatgagaat
tacgcaaaacttattcctggagctacagtagggctacttcagaaggactccggaaacatt
ctccagctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtatta
ggagacactgaaggactcaacttgtcatttacagccatctgtaacaacggtacattcttc
caacaccaaaagaaatgctctcacatgaaagtgggagacacagcttccttcaacgtgact
gtgaatatcccaaactgtgagagaagaagcaggcacattatcataaagcctgtggggctg
ggggacgccctggaattacttgtcagtccagaatgcaactgtgactgtcagaaagaagtg
gaagtgaacagctccaaatgtcaccacgggaacggctccttccagtgtggagtgtgtgcc
tgccaccctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagat
tcctgcaaggaggccccagatcatccctcctgcagtggaaggggtgactgctactgtggg
cagtgtatctgccacttgtctccctatggaaacatttacgggccttattgccagtgtgac
aatttttcctgcgtgagacacaaagggctactctgcggagacaatggcgactgtgactgt
ggtgagtgtgtatgcaggagcggctggactggcgaatactgcaactgcaccaccagcacg
gactcctgcatctctgaagacggagttctctgcagcgggcgcggggactgcgtttgtggc
aagtgtgtttgcgcaaacccgggagcctcaggaccaacctgtgaacgatgtcctacctgt
ggtgacccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaa
gcccgagaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttatt
acattcctgataactacagataatgaggggaaaagcatcattcacagcatcagtgaaaaa
gattgtccaaagcctccaaacattcccatgatcatgttgggggtttccctggctattctt
ctcatcggggttgtcctgctgtgcatctggaagctgctggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacgatcaaaagccaagtggcaaacgggaaccaatcca
ctctacagaggctccacaagtacttttaaaaatgtaacttataaacacagggaaaaacaa
aaggtggacctttccacagatggatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681299
Entry
104681299         CDS       T03989                                 

Gene name
ITGB4
Definition
(RefSeq) integrin beta-4 isoform X4
  KO
K06525  integrin beta 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104681299 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104681299 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104681299 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104681299 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104681299 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104681299 (ITGB4)
   05414 Dilated cardiomyopathy
    104681299 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104681299 (ITGB4)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104681299 (ITGB4)
  Exosomal proteins of bladder cancer cells
   104681299 (ITGB4)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104681299 (ITGB4)
CD molecules [BR:rro04090]
 Proteins
  104681299 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail I-EGF_1 PSI_integrin Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 104681299
NCBI-ProteinID: XP_010385881
UniProt: A0A2K6N7I1
LinkDB
Position
19
AA seq 1806 aa
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPRESPVDLYILMDFSNSMSDDLDNLKKMGQNLAQVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDEQCHLDATGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGFRTEVTSKMFQKMKTGSFQIQRGEVGIYQVQLRAIEHVDG
THVCQLPKEDQKGNVHLKPSFSDGLKMDAGIICDVCPCELQKEVRSARCNFNGDFMCGHC
VCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVD
ELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPSSFWWLIPLLL
FLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDVVRWKVTNSVQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTRE
CAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALL
KLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDEEKQ
LLVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEYSVSRGDQVARIPVIRRVLDG
GKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQIRRF
HVQLSNPKFGAHLGQPNSTTIIIRDSDELDRSLTSQMVLSQPPPHGDLGAPQNPNAKAAG
SRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTEHLVNGRMDF
AFPGSANSLHRMTTTGAAAYGTHLSPHVPHRGLSTSSTLTRDYHSLTRSEHSHSTTMPRD
YSTLTSVSSHGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIILAGRPAAPS
WGPDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLN
IPNPAQTTVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSTF
TLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATTFRVDGDS
PESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHAGLFQHPL
QSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTQVD
QQFFQT
NT seq 5421 nt   +upstreamnt  +downstreamnt
atggcagggccacgccccagcccatgggccaggctgctactggcagccttgatcagcgtc
agcctctctgggaccttggcaaaccgctgcaagaaggccccagtgaagagctgcacggag
tgtgtccgtgtggataaggactgcgcctactgcacggacgagatgttcagggaccggcgc
tgcaacacccaggcagagctgctggccgcgggctgtcagcgcgagagcatcgtggtcatg
gagagcagcttccagattacagaggagacccagattgacaccaccctgcggcgcagccag
atgtccccccagggcctgcgggtccggctgcggcccggtgaggagcggcactttgagctg
gaggtgtttgagccccgggagagccccgtggacctgtatatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagaagatgggacagaacctggctcaggtcctg
agccagctcaccagcgactacactattggatttggcaagttcgtggacaaagtcagcgtc
ccgcagacagacatgaggcctgagaagctgaaggagccctggcccaacagtgaccccccc
ttctccttcaagaacgtcatcagcctaacagaagatgtggatgagttccggaataaactg
cagggagagaggatctcaggcaacctggacgctcctgagggcggctttgatgccatcctg
cagacggccgtgtgcacgagggacattggctggcgcccggacagcacccacctgctggtc
ttctccaccgagtcggccttccactatgaggctgacggtgccaacgtgctggctggcatc
atgagccgcaacgatgaacagtgccacctggacgccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccctggtgcgcctgctcgccaagcacaacatcatc
cccatctttgctgtcaccaactactcctatagctactatgagaagcttcacacctatttc
cccgtctcctcgctgggggtgctgcaggaggactcgtccaacatcgtggagctgctggag
gaggccttcaatcgaatccgctccaacctggacatccgggccctagacagcccccgaggc
tttcggacagaggtcacctccaagatgttccagaagatgaagactgggtcctttcagatc
cagcgaggggaagtgggcatataccaggtgcagctgcgggccatcgagcacgtggatggg
acgcacgtgtgccagctgccgaaggaggaccagaagggcaacgtccatctgaaaccttcc
ttctctgatggcctcaagatggacgcgggcatcatctgtgatgtgtgcccctgcgagctg
caaaaagaggtgcggtcagctcgctgcaacttcaatggagacttcatgtgtggacactgt
gtgtgcagtgagggctggagtggccagacctgcaactgctctaccggctctctgagtgac
attcagccctgcctgcgggagggtgaggacaagccatgctcgggccgtggggagtgccag
tgcgggcactgtgtgtgctacggcgaaggccgctacgagggtcagttctgcgagtatgac
aacttccagtgtccccgcacttccgggttcctctgcaatgaccgaggacgctgctccatg
ggccagtgtgtgtgtgagcctggttggacaggcccaagctgtgactgtcccctcagcaat
gccacctgcatcgacagcaatgggggcatctgtaatggacgtggccactgtgagtgtggc
cgttgccactgccaccagcagtcactttacacggacaccatctgtgagatcaactactcg
gcgatccacccgggcctctgcgaggacctacgctcctgcgtgcagtgccaggcatggggc
accggggagaagaaggggcgcacatgtgaggaatgcaacttcaaggtcaagatggtggac
gagcttaagagagccgaggaggtggtggtgcgctgctccttccgggacgaggatgatgac
tgcacctacagctacaccatggaaggcgacggcgcccctgggcccaacagcaccgtcctg
gtgcacaagaagaaggactgccctcccagctccttctggtggctcattcccctgctcctc
ttcctcctgccactcctggccctgctgctgctgctctgctggaagtactgcgcctgctgc
aaggcctgcctggcacttctcccttgctgcaaccgaggtcacatggtgggctttaaggaa
gaccactacatgctgcgggagaacctgatggcctcagaccacctggacacacccatgctg
cgcagtgggaacctcaagggccgtgacgtggtccgctggaaggtcaccaacagcgtgcag
cggcctggctttgccactcatgccgccagcatcaaccccacagagctggtgccctacggg
ctgtccttgcgcctggcccgcctttgcactgagaacctgctaaagcctgacactcgggag
tgtgcccagctgcgccaggaggtggaggagaacctgaacgaagtctacaggcagatctcc
ggtgtacacaagctccagcagaccaagttccggcagcagcccaatgctgggaaaaagcaa
gaccacaccattgtggacacagtgctgatggcgccccgctcggccaagccggccctgctg
aagctgacagagaagcaggtggaacagagggccttccacgacctcaaggtggcccctggc
tactacacccttactgcagaccaggacgcccggggcatggtggagttccaggagggcgtg
gagctggtggacgtacgggtgcccctctttatccggcctgaggacgacgaggagaagcag
ctgctggtggaggccatcgatgtacctgcgggcactgccacccttggccgccgtctggta
aacatcaccatcatcaaggagcaagccagagatgtggtgtcctttgagcagcctgagtac
tcggtcagccgtggggaccaggtggcccgcatccctgtcatccggcgcgtcctggacggc
gggaagtctcaggtctcctaccgcacgcaggatggcactgcgcagggcaaccgggactac
atccctgtggagggtgagctgctgttccagcctggagaggcctggaaagagctgcaggtg
aagctcctggagctgcaagaggtcgactcccttctgcggggccgccagatccgccgtttc
cacgtacagctcagcaaccctaagtttggggcccacctgggccagcccaactccaccacc
atcatcatcagggactcagatgaactggaccggagcctcacgagtcagatggtgttatca
cagccaccccctcatggtgacctgggcgccccgcagaaccccaacgctaaggccgctggg
tccaggaagatccatttcaactggctgcccccttctggcaagccaatggggtacagggta
aagtactggattcagggtgactctgagtccgaagcccacctgctcgacagcaaggtgccc
tcagtggagctcaccaacctgtacccgtattgcgactatgagatgaaggtgtgcgcctac
ggggctcagggcgagggaccctacagctccctggtgtcctgccgcacccaccaggaagtg
cccagcgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagc
tgggctgagccggctgagaccaacggtgagatcacagcctatgaggtctgctatggcctg
gtcaacgacgacaaccgacctatcgggcccatgaagaaggtgctggttgacaatcctaag
aaccggatgctgcttattgagaaccttcgggagtcccagccctaccgctacacggtgaag
gcgcgcaacggggctggctgggggcccgagcgggaggccatcatcaacctggccacccaa
cccaagcggcccatgtccatccccatcatccctgacattcccatcgtggatgcccagagc
ggggaggactacgacagcttccttatgtacagcgatgatgttctacgctcgccatctggc
agccagaggcccagcgtctctgatgacaccgagcacctggtgaatggccggatggacttt
gccttcccgggcagcgccaactccctgcacaggatgaccacgactggtgccgctgcctat
ggcacccacctgagcccgcacgtgccccaccgtggactaagcacatcctccaccctcaca
cgggactaccactcgctgacccgctcggaacactcacactcgaccacaatgcccagggac
tactccaccctcacctccgtctcctcccatggcctccctcccatctgggaacacgggagg
agcaggcttccgctgtcctgggctctggggtcccggagtcgggctcagatgaaagggttc
cccccttccaggggcccacgagactctataatcctggctgggaggccagcagcgccctcc
tggggcccagactctcgcctgaccgctggtgtgcccgacacgcccacccgcctggtgttc
tctgccctgggacccacatctctcagagtgagctggcaggagccacggtgcgagcggccg
ctgcagggctacagcgtggagtaccagctgctgaacggcggcgagctacatcggctcaac
atccccaaccctgcccagaccacggtggtggtggaagacctcctgcccaaccactcctat
gtgttccgcgtgcgggcccagagccaggaaggctggggccgagagcgtgagggtgtcatc
accatcgaatcccaggtgcacccgcagagcccactctgtcccctgccaggctccaccttc
actttgagcactcccagcgccccaggcccactagtgttcactgctctgagcccagactcg
ctgcagctgagctgggagcggccacggaggcccaatggggatatcgtcggctacctggtg
acctgtgagatggcccaaggaggagggccagccactacattccgggtggatggagacagc
cctgagagccggctgaccgtgccgggcctcagcgagaacgtgccctacaagttcaaggtg
caggccaggaccactgagggcttcgggccagagcgcgagggcatcatcaccatagagtcc
caggatggaggccccttcccacagctgggcagccatgccgggctcttccagcacccactg
caaagtgagtacagcagcatcaccaccacccacaccagcgccaccgagcccttcctagtg
gatgggctgaccctgggggcccagcacctggaggcaggcggctccctcacccggcatgtg
acccaggagtttgtgagccggacgctgaccaccagcggaaccctcagcacccaggtggac
caacagttcttccaaacctga

DBGET integrated database retrieval system