KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655463
Entry
104655463         CDS       T03989                                 

Gene name
ROCK1
Definition
(RefSeq) LOW QUALITY PROTEIN: rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04270  Vascular smooth muscle contraction
rro04350  TGF-beta signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04530  Tight junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro04921  Oxytocin signaling pathway
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104655463 (ROCK1)
   04071 Sphingolipid signaling pathway
    104655463 (ROCK1)
   04024 cAMP signaling pathway
    104655463 (ROCK1)
   04022 cGMP-PKG signaling pathway
    104655463 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655463 (ROCK1)
   04530 Tight junction
    104655463 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104655463 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104655463 (ROCK1)
   04670 Leukocyte transendothelial migration
    104655463 (ROCK1)
   04062 Chemokine signaling pathway
    104655463 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104655463 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104655463 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    104655463 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655463 (ROCK1)
   05206 MicroRNAs in cancer
    104655463 (ROCK1)
   05205 Proteoglycans in cancer
    104655463 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104655463 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104655463 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104655463 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104655463 (ROCK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104655463 (ROCK1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   104655463 (ROCK1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104655463 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 FPP APH HR1 Pkinase_C
Other DBs
NCBI-GeneID: 104655463
NCBI-ProteinID: XP_010353190
UniProt: A0A2K6RJ43
LinkDB
Position
21
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMXKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHAVSRLEETNSMLTKDMEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKTTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcgatttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaatcagagatttacgaatgaaagccgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgnataagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaatagtccgtgggttgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcacagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggaagagagtgtgac
tggtggtcggttggggtatttttatacgaaatgcttgtaggtgatacacctttttatgca
gattctttggttggaacttacagtaaaattatgaaccataaaaattcacttacctttcct
gatgataatgacatatcaaaagaagcaaaaaaccttatttgtgccttccttactgacagg
gaagtgagattaggacgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gaccagtgggcttgggaaacactccgagatactgtagcaccagttgtacctgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagaggaagaaaca
ttccctattcctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataacagaactagctccaatgca
gataaaagcttgcaggaaagtttgcagaaaacaatctataagctggaagaacagctgcat
aatgaaatgcagttaaaagatgaaatggagcagaagtgcagaacctcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaatctagaatctaca
gtgtctcaaattgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagctgaacaggaaaatgagaagagaagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtaagtcagaattcacaacttgctaatgagaagctg
tcccagttacaaaagcagctagaagaagccaatgacttacttaggacagaatcggacaca
gctgtaagactgaggaagagtcacacagaaatgagcaagtcaattagtcagttagagtcc
ctgaacagagagttgcaagagagaaatcgaattttagagaattctaagtcacaaacagac
aaagattattaccagctgcaagctatattagaagctgaacgaagagacagaggtcatgat
tctgagatgatcggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatctcgaaaaagtggaaggagaaagaaaagaggctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagagatagatttaaactacaaacttaaatcatta
caacaacggttagaacaagaggtaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgtggcaatgtgtgagatggaaaaaaagctg
aaagaagaaagagaagctcgagagaaggctgaaaatcgggttgttcagattgagaaacag
tgttccatgctagacgttgatctgaagcaatctcagcagaaactagaacatttgactgga
aataaagaaaggatggaggatgaagttaagaatctaaccctgcaactggagcaggaatca
aataagcggctgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacgaaacagtatagagggaatgaaggacagatgcgg
gagctacaagatcagcttgaagctgaacaatatttctcgacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggctcgaggccttctggaagaacagtattttgaattgactcaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacgctgttagtcgg
cttgaagaaacaaacagcatgctaaccaaagatatggaaatattaagaagagagaacgaa
gagctaacagagaaaatgaagaaggcagaggaagaatataaattggagaaggaggaggag
atcagtaatcttaaggctgcctttgaaaagaatatcaacactgagcgaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaagaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggagctgaat
gacatgcaagcgcaattggtagaagaatgtgcacataggaatgagcttcagatgcagttg
gccagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctctcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaacctcccagagtcaaga
attgaaggttggctttcagtaccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgatgaacaagataaggag
caatccaatccatctatggtattggacatagataaactgtttcacgttagacctgtaacc
caaggagatgtgtatagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagacgtagagatggaaccagtacaacaagctgaaaaa
actaatttccaaaatcataaaggccatgagtttattcctacactctaccactttcctgcc
aattgtgatgcctgtgccaaacctctctggcatgtttttaagccaccccctgccctagag
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tgtccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaaaatccctaagaatcca
ccatctggttttgttcgtgcctcccctcgaacactttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaactacatctggaaaaactagttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675191
Entry
104675191         CDS       T03989                                 

Gene name
ROCK2
Definition
(RefSeq) rho-associated protein kinase 2 isoform X5
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04530  Tight junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro04921  Oxytocin signaling pathway
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104675191 (ROCK2)
   04071 Sphingolipid signaling pathway
    104675191 (ROCK2)
   04024 cAMP signaling pathway
    104675191 (ROCK2)
   04022 cGMP-PKG signaling pathway
    104675191 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675191 (ROCK2)
   04530 Tight junction
    104675191 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675191 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675191 (ROCK2)
   04670 Leukocyte transendothelial migration
    104675191 (ROCK2)
   04062 Chemokine signaling pathway
    104675191 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104675191 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104675191 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    104675191 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675191 (ROCK2)
   05205 Proteoglycans in cancer
    104675191 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104675191 (ROCK2)
   05135 Yersinia infection
    104675191 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104675191 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104675191 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104675191 (ROCK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104675191 (ROCK2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   104675191 (ROCK2)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104675191 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 104675191
NCBI-ProteinID: XP_010377966
LinkDB
Position
17
AA seq 1388 aa
MSRPPPTGKMPGAPETVPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRENDSIQSRKNEESQEIQKKLYTLEEHLSSEIQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKNGKI
LIAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSILDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPARNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaaaatgcccggcgcccccgaaaccgtgccgggggac
ggggccggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctccccc
atcaacgtggagagcttgctggatggcttaaattccttggtccttgatttagattttcct
gctttgagaaaaaacaagaacatagataatttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggtctacagatgaaggcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtgcagttggttcgtcataaggcatcgcagaaggtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcctttttttgggaagaa
agagatattatggcctttgccaatagcccctgggtggttcagcttttttatgcctttcaa
gatgataggtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaattatgatgtgcctgaaaaatgggccaaattttacactgctgaagttgttctt
gctctggatgcaatacactccatgggtttaatacacagagatgtgaagcctgacaacatg
ctcttggataaacatggacatctaaaattagcagattttggcacgtgtatgaagatggat
gaaacaggcatggtacattgtgatacagcagttggaacacctgattatatatcacctgag
gttctgaaatcacaagggggtgatggttactatgggcgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgctagtgggggatactccattttatgcggattcacttgta
ggaacatatagcaaaattatggatcataagaattcactgtgtttccctgaagatgcagaa
atttccaaacatgcgaaaaatctcatctgtgctttcttaacagatagggaggtacgactt
gggagaaatggggtagaagaaatcagacaacatcctttctttaagaatgatcagtggcat
tgggataacataagagaaacggcagctcctgtagtacctgaactcagcagtgacatagac
agcagcaatttcgatgacattgaagatgacaaaggagatgtagaaaccttcccaattcct
aaagcttttgttggaaatcagctgcctttcataggatttacctactatagagaaaattta
ttattaagtgactctccatcttgtagagaaaatgattcaatacaatcaaggaaaaatgaa
gaaagtcaagagattcagaaaaaactgtatacattagaagaacatcttagcagtgagata
caagccaaagaggaactggaacagaagtgcaaatctgttaatactcgcctagaaaaaaca
gcaaaggagctagaagaggagattaccttaaggaaaagtgtggaatcagcattaaggcag
ttagaaagagaaaaggcgcttcttcagcacaaaaatgcagaatatcagaggaaagctgat
catgaagcagacaagaaacgaaatttggaaaatgatgttaacagcttaaaagatcaactt
gaagatttgaaaaaaagaaatcaaaactctcaaatatccactgagaaagtgaatcaactc
cagagacaactggatgaaaccaatgctttactgcgaacagaatctgatactgcagcccgg
ttaaggaaaacccaggcagaaagttcaaaacagattcagcagctagaatctaacaataga
gatctacaagataaaaactgcctgctggagactgccaagttaaaacttgaaaaggaattt
atcaatcttcaatcagcactagaatctgaaaggagggatcgaacccatggatcagagata
attaatgatttacaaggtagaatatctggcctagaagaagatttaaagaacggcaaaatc
ttaatagcgaaagtagaactggagaagagacaactgcaggagagatttactgatttggaa
aaggaaaaaagcaacatggaaatagatatgacataccaactaaaagttatacagcagagc
ctagaacaagaagaagctgaacataaggccacaaaggcacgactagcagataaaaataag
atctatgagtccatcgaagaagccaaatcagaagccatgaaagaaatggagaagaagctc
ttggaggaaagaactttaaaacagaaagtggagaacctattgctagaagctgagaaaaga
tgttctatattagactgtgacctcaaacagtcacagcagaaaataaatgagctccttaaa
cagaaagatgtgctaaatgaggatgttaggaacctgacattaaaaatagagcaagaaact
cagaagcgctgccttacacaaaatgacctgaagatgcaaacacaacaggttaacacacta
aaaatgtcagaaaagcagttaaagcaagaaaataaccatctcatggaaatgaaaatgaac
ttggaaaaacaaaatgctgaacttcgaaaagaacgtcaggatgcagatgggcaaatgaag
gagctccaggatcagctcgaagcagaacagtatttctcaaccctttataaaacacaagtt
agggagcttaaagaagaatgtgaagaaaagaccaaacttggtaaagaattacagcaaaag
aaacaggaattacaggatgaacgggactccttggctgcccaactggagatcaccttgacc
aaagcagattctgagcaactggctcgttcaattgctgaagaacaatattctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctagacacaaacaggaa
cttaccgaaaaagatgccacaattgcttctcttgaagaaactaataggacactaactagt
gatgttgccaatcttgcgaatgagaaagaagaattaaataacaaactgaaagatgttcaa
gagcaactgtcaagattgaaagacgaagaaataagcgcagcagctattaaagcacagttc
gagaaacagctgttaacagaaagaacactcaaaactcaagctgtgaataagttggctgag
atcatgaatcgaaaagaacctgtcaagcgtggtaatgacacagatgtgcggagaaaagag
aaggagaatagaaagctacatatggagcttaaatctgaacgtgagaaattgacccagcag
atgatcaagtatcagaaagaactgaatgaaatgcaggcacaaatagctgaagagagccag
attcgaattgaactgcagatgacattggacagtaaagacagtgacattgagcagctgcga
tcacaactccaagccttgcatattggtctggatagttccagtataggcagtggaccaggg
gatgctgaggcagatgatgggtttccagaatcaagattagaaggatggctttcattgcct
gcacgaaacaacactaagaaatttggatgggttaaaaagtatgtgattgtaagcagtaag
aagattcttttctatgacagtgaacaagataaagaacaatctaatccttacatggtttta
gatatagacaagttatttcatgtccgaccagttacacagacagatgtatatagagcagat
gctaaagaaattccgaggatattccagattctgtatgccaatgaaggagaaagtaagaag
gaacaagaatttccagtggagccagttggagaaaaatctaattatatttgccacaaggga
catgagtttattcctactctttatcatttcccaaccaactgtgaggcttgtatgaagccc
ctgtggcacatgtttaagcctcctcctgctttagagtgtcgccgttgccatattaagtgt
cataaagaccacatggacaaaaaggaggagattatagcaccttgcaaagtgtattatgat
atttcaacggcaaagaatctattattactagcaaactctacagaagagcagcagaagtgg
gttagtcgattggtgaaaaagatacctaaaaagcccccagctccagacccttttgcacga
tcatctcctagaacttcaatgaagatacagcaaaaccagtctattagacggccaagtcga
cagcttgccccaaacaaacctagctaa

DBGET integrated database retrieval system