KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655475
Entry
104655475         CDS       T03989                                 

Gene name
ADCYAP1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04713  Circadian entrainment
rro04911  Insulin secretion
rro04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104655475 (ADCYAP1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104655475 (ADCYAP1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104655475 (ADCYAP1)
   04924 Renin secretion
    104655475 (ADCYAP1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104655475 (ADCYAP1)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 104655475
NCBI-ProteinID: XP_010353208
UniProt: A0A2K6RHE1
LinkDB
Position
21
AA seq 176 aa
MTMCSGARLALLVYGIIMHSSVYCSPAAAGLRFPGIRPEEEAYDEDGNPLQDFYDLEPPG
AGSPASALRDASALYYPSERRDVAHGILNKAYRKVLDQLSARKYLQSLVAKGVGGSLGGG
VEEDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcgaggctggccctgctggtctacgggataatcatgcacagc
agcgtctactgctcacctgccgccgccggactccggttccccgggatcaggccagaggaa
gaggcgtacgacgaggacggaaacccgctgcaagacttctacgacttggagccgccaggc
gcagggagccccgcctccgcgctgcgcgacgcctccgcattgtactacccctccgagaga
agagatgtcgcccacgggatccttaacaaggcctaccgcaaagtgctggaccagctgtcc
gccaggaagtacctgcagtcgctcgtggcgaagggcgtgggtgggagcctaggcggcggc
gtggaggaggacgcggagccgctctccaagcgccattcggatggaatcttcacggacagc
tacagtcgctaccggaaacaaatggctgtcaagaaatatttggcggccgtcctagggaaa
aggtataaacaaagggttaaaaacaaaggacgccgaatagcttatttgtag

DBGET integrated database retrieval system