KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655589
Entry
104655589         CDS       T03989                                 

Gene name
CDH1
Definition
(RefSeq) LOW QUALITY PROTEIN: cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04371  Apelin signaling pathway
rro04390  Hippo signaling pathway
rro04514  Cell adhesion molecules
rro04520  Adherens junction
rro05100  Bacterial invasion of epithelial cells
rro05200  Pathways in cancer
rro05213  Endometrial cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104655589 (CDH1)
   04390 Hippo signaling pathway
    104655589 (CDH1)
   04371 Apelin signaling pathway
    104655589 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104655589 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104655589 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655589 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    104655589 (CDH1)
   05216 Thyroid cancer
    104655589 (CDH1)
   05218 Melanoma
    104655589 (CDH1)
   05219 Bladder cancer
    104655589 (CDH1)
   05213 Endometrial cancer
    104655589 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    104655589 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104655589 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rro04515]
    104655589 (CDH1)
   04090 CD molecules [BR:rro04090]
    104655589 (CDH1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    104655589 (CDH1)
Cell adhesion molecules [BR:rro04515]
 Cadherins
  Major cadherins
   104655589 (CDH1)
CD molecules [BR:rro04090]
 Proteins
  104655589 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_3 BACON_2 Phage_holin_5_2
Other DBs
NCBI-GeneID: 104655589
NCBI-ProteinID: XP_010353338
UniProt: A0A2K6R725
LinkDB
Position
20
AA seq 883 aa
MGPWSRSLSALLLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVSFED
CTGRQRTAYFSLDTRFKVGPDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKVTLNTV
GHHSRPPPLHASVSGVQAELLTFPNSSPGLRRRKRDWVIPPISCPENEKGPFPKNLVQIK
SNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRENIATYTLFSHAVSSNG
NAVEDPMEILITVTDQNDNKPVFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAA
IAYTILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPMYTLVVQAADLQGEGLSTTA
TAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDN
DGQFVVTTNPVTNDGILKTAKGLDFEAKQQYILHVAVTNVAPFEVSLTTSTATVTVDVLD
VNEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDTANWLEINPDT
GAISTRAELDREDSEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRN
IFLCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIEYNDPTQESIILKPKIALE
VGDYKINLKLMDNQNKDQVTTLEVSVCDCEGATGVCKKAPLVEAGLQIPAILGILGGILA
LLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDAR
PEVTRNDVAPTLLSVPRYLPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSG
SEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggcccttggagccgcagcctgtcggcgctgctgctgctgctgctgcaggtctcgtct
tggctctgccaggagccggagccttgccaccccggctttgacgccgagagctacacgttc
acggtgccccggcggcacctggagagaggacgcgtcctgggcagagtgagttttgaagat
tgcaccggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggccca
gacggtgtgattacagtcaaaaggcctctacagtttcataacccacagatccatttcttg
gtctacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtg
gggcaccacagccgccccccgccccttcatgcctctgtttctggagtccaagcagaattg
ctcacatttcccaactcctctcctggactcagaagacggaagagagactgggttattcct
cctatcagctgtccagaaaatgaaaaaggcccatttcctaaaaatctggttcagatcaaa
tccaacaaagataaagaaggcaaggttttctatagcatcactggccaaggagctgacaca
ccgcctgttggtgtctttattattgaaagagaaacaggatggctgaaagtgacagagcct
ctggatagagaaaacattgccacatacactctcttctctcatgctgtgtcatccaacggg
aatgcagttgaggacccaatggagattttgatcacggtgactgatcagaatgacaacaag
cccgtgttcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccagggacc
tccgtaatggaggtcacagccacagatgcggacgacgatgtgaacacctacaatgccgcc
atcgcttacaccatcctcagccaagatcctgagctgcctgacaaaaatatgttcaccatt
aacaagaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccct
atgtataccctggtggttcaagctgctgaccttcaaggtgaggggttaagcacaacagca
acagctgtgatcacagtcactgacaccaatgataaccctccgatcttcaatcccaccacg
tacaagggtcaggtgcctgagaacgaggctaacgtcgtaatcaccacactgaaagtgact
gatgctgacgcccccaataccccagcgtgggaggctgtatacactatattgaatgataat
gacggacaatttgttgtcaccacaaatccagtgaccaacgatggcattttgaaaacagca
aagggcttggattttgaggccaagcagcagtacattctacacgtggcagtgacgaacgtg
gcgccctttgaggtctccctcaccacctccacagccactgtcaccgtggatgtgctggat
gtgaacgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtctgaggacttt
ggcgtgggccaggaaatcacatcctacaccgcccgggagccagacacatttatggaacag
aaaataacgtatcggatttggagagacactgccaactggctggagattaatccggacact
ggtgccatttccactcgggctgagctggacagggaggattctgagcacgtgaagaacagc
acgtacacagccctcatcatagctacagacaatggttctccagttgctactggaacaggg
actcttttgctgatcctgtctgatgtgaatgacaacgcccccataccagaacctcgaaat
atattcttgtgcgagaggaatccaaagcctcaggtcataaacatcattgatgcagacctt
cctcccaatacatctcccttcacagcagaactaacgcacggggcgagtgccaactggacc
attgagtacaacgacccaacccaagaatctatcattttgaagccaaagatagccttagag
gtgggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgacc
accttagaggtcagcgtgtgtgactgtgaaggggccaccggcgtctgtaagaaggcacca
cttgttgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgct
ttgctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagag
cccttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaagga
ggtggagaagaggaccaggactttgacttgagccagttgcacaggggcctggacgctcgg
cctgaagtgactcgtaacgacgttgcaccaaccctcctgagtgtcccccggtatcttccc
cgccctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaggcggctgat
agtgaccccacggccccgccttatgattctctgctcgtgtttgactatgaaggaagcggt
tccgaagctgctagtctgagctccctgaattcttcagagtcagacaaagaccaggactat
gattacttgaatgaatggggcaatcgcttcaagaagctggcagacatgtacggaggcggc
gaggatgactag

DBGET integrated database retrieval system