KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655599
Entry
104655599         CDS       T03989                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04625  C-type lectin receptor signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04921  Oxytocin signaling pathway
rro05135  Yersinia infection
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104655599 (NFATC3)
   04310 Wnt signaling pathway
    104655599 (NFATC3)
   04022 cGMP-PKG signaling pathway
    104655599 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104655599 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104655599 (NFATC3)
   04660 T cell receptor signaling pathway
    104655599 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    104655599 (NFATC3)
   04659 Th17 cell differentiation
    104655599 (NFATC3)
   04662 B cell receptor signaling pathway
    104655599 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104655599 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    104655599 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104655599 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104655599 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104655599 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    104655599 (NFATC3)
   05161 Hepatitis B
    104655599 (NFATC3)
   05163 Human cytomegalovirus infection
    104655599 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104655599 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104655599 (NFATC3)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104655599 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 104655599
NCBI-ProteinID: XP_010353353
UniProt: A0A2K6PXG9
LinkDB
Position
20
AA seq 1075 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLNTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCESPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAREDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSD
DQGSLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSGHSHDSVLSAQRSLVCSIPQTYASMVTSSHLPQLQCRDESASKEQHM
IPSPVVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLPG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD
QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQSMPYQSPSSGTA
SSPSRATRMHSGQHSSQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDRE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcaccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaacacaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaagtcacaaaaactatgaaggaacttgtgagagtcctgaatctaaatatagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatctatctctcctaactgt
catcaagaaatagatgcacgtgaagatgacctacagataaatgacccagaacgggaattt
ttggaaaggccttctagagatcatctctatcttcctcttgaaccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagctggttctctgatgcatct
tcttgtgaatcactttcacatatttatgatgatgtagactcagagttgaatgaagctgca
gcccgatttacccttggatcccctctgacttctcctggtggctctccagggggctgccct
ggagaagaaacttggcatcaacagtatggacttggacactcattatcacccaggcaatct
ccttgccactctcctagatccagtgtcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcccacgtctccctgtgggaaacggaggcactccagtgctgaa
gtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggtcactcc
cccaggggaagtgtgacagaagatacctggctgaatgcttctgtccatggtgggtcaggc
cttggccctgcagtttttccatttcagtactgtgtagagactgacatccctctgaaaaca
aggaaaacttctgaagatcaagctgccatactaccaggaaaattagagctctgttcagat
gaccaaggaagtttatcaccatcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgatcagtttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccagctcattttggacaatgtgaactgaaaatagaagtgcagcctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctact
gggggacatcctgttgtgaagctcctgggctataacgaaaagccgataaatctacaaatg
tttattgggacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagacagtcgctactgcaagccaagagataataattgccagtacaaaagtt
ctggaaattccacttcttcctgaaaacaatatgtcagccagcattgattgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccaatggaaaagtgctt
tctctgcagatagcctctatacccgttgagtgctcccagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaagataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagtt
ttgatgaagcaagaacacagagaagagattgatttgtcttcagttccatctttgcctgtg
cctcatcctgctcagacccagaggccttcctctgattcagggcattcacatgacagtgta
ctgtcagcacagagaagtttggtttgttccatcccacaaacatatgcatccatggtgacc
tcatcccatctgccacagttgcagtgtagagatgagagtgctagtaaagaacagcatatg
attccttctccagttgtacaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcagcctatgcaaactaacgttgtgtacaatggaccaacttgtcttcctattaat
gctgcctctagtcaagaatttgattcagttttgtttcagcaggatgcaactcttcctggt
ttagtgaatcttggctgtcaaccactgtcatccataccatttcattcttcaaattcaggc
tcaacaggacatctcttagcccatacacctcattctgtgcataccctgcctcatctacaa
tcaatgggatatcattgttcaaatacaggacaaagatctctttcttctccagtggctgac
cagattaccggtcagccttcttctcagttacaacctattacatatggtccttcacattca
gggtctgctacaacagcttccccagcagcttctcatcccttggctagttcaccactttct
gggccaccgtctcctcagcttcagtctatgccttaccaatctcctagctcaggaactgcc
tcatcaccgtctcgagctaccagaatgcattctggacagcactcaagtcaagcacaaagt
acaggccaggggggtctttctgcaccttcatccttaatatgtcacagtttgtgtgatcca
gcttcatttccacctgatggggcaactgtgagcattaaacctgaaccagaagatcgggag
cctaactttgcaaccattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggagcaggggtgagcaggcaggctccc
ctcccgagtcctgagtccctggatttaggaagatctgatggactctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662367
Entry
104662367         CDS       T03989                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04921  Oxytocin signaling pathway
rro05135  Yersinia infection
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104662367 (NFATC2)
   04370 VEGF signaling pathway
    104662367 (NFATC2)
   04022 cGMP-PKG signaling pathway
    104662367 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104662367 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104662367 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    104662367 (NFATC2)
   04660 T cell receptor signaling pathway
    104662367 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    104662367 (NFATC2)
   04659 Th17 cell differentiation
    104662367 (NFATC2)
   04662 B cell receptor signaling pathway
    104662367 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104662367 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    104662367 (NFATC2)
   04380 Osteoclast differentiation
    104662367 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104662367 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104662367 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662367 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    104662367 (NFATC2)
   05161 Hepatitis B
    104662367 (NFATC2)
   05163 Human cytomegalovirus infection
    104662367 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104662367 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104662367 (NFATC2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104662367 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 104662367
NCBI-ProteinID: XP_010361672
UniProt: A0A2K6RF59
LinkDB
Position
13
AA seq 925 aa
MNAPEQQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQNLLSAAKPAGASGLSPRIEITPSHE
LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR
PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGAPAGYPPVAGS
AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER
RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT
GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT
RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
QNFTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV
INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA
HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
DQTYLDDVNEIIRKEFSGPPARNQT
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgaacgcccccgagcagcagccccaacctgacggcggggacgccccaggccacgagccc
gggggcagcccccaagacgagcttgacttctccatcctcttcgactatgagtatttgaat
ccgaacgaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccccttgctagtctctctggc
gagccccccggccgattcggagagccggatagggtagggccgcagaacttgctgagcgcg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcagtgggccccctccgcatgagagacgcaggcctcctggtggagcagccg
cccctggccggggtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttct
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgcgccgaggccttg
gttgccctgccgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctca
tctcacgtggcaccccaggaccacggcgctcccgctgggtacccccctgtggctggctct
gccgtgatcatggatgccctgaacagccttgccacggactcgccttgtgggatccccccc
aagatgtggaagaccagccctgacccctcgccggtgtctgcggccccatccaaggccggc
ctgcctcgccacatctacccggccgtggagttcctggggccctgcgagcagggggagagg
agaaactcggctcccgaatccatcctgctggttccgcccacttggcccaagccgctggtg
cctgccattcccatctgcagcatcccagtgactgcatccctccctccacttgagtggccg
ctgtccagtcagtcaggatcttatgagctgcggatcgaggtgcagcccaagccacatcac
agggcccactatgagacagaaggcagccgaggggccgtcaaagctccaactggaggccac
cctgtggttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcatt
gggacagccgatgagcgaattcttaagccgcatgccttctaccaggtgcaccgaatcacg
gggaaaactgtcaccaccaccagctatgagaagattgtgggcaacaccaaagtcctggag
atccccctggagcccaaaaacaacatgagggcaaccatcgactgtgcggggatcttgaag
cttagaaacgctgacattgagctgcggaaaggcgagacggacattggaagaaagaatacg
cgggtgaggctggttttccgagttcacatcccagagtccagtggcagaatcgtctcttta
cagactgcatctaatcccatcgagtgctcccagcgatctgctcacgagctgcccatggtt
gaaagacaagacacggacagctgcctggtctatggtggccagcaaatgatcctcacgggg
cagaactttacggctgagtccaaagtcgtgtttactgagaagaccacagatgggcagcaa
atctgggagatggaagccacagtggataaggacaagagccagcccaacatgctttttgtt
gagatccctgaatatcggaacaagcacatccgcacacctgtaaaagtgaacttctacgtc
atcaatgggaagagaaaacgaagtcagcctcagcactttacctaccacccagtcccagcc
atcaagacggagcccacggatgaatatgaccccactctgatctgcagccccacccacgga
ggcctggggagccagccttactacccccaacacccgatggtggccgagtccccctcctgc
ctcgtggccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgcc
cgctaccagcaacagaacccagcggccgtactctaccagcggagcaagagcctgagcccc
agcctgctgggctaccagcagccggccctcatggccgccccactgtcccttgcggacgct
caccgctctgtgctggtgcacgctggctcccaggggcagagctctgccctgctccacccc
tctccgaccaatcagcaggcctcgcctgtgatccactactcacccaccaatcagcagctg
cgctgcggaagccaccaggagttccagcacatcatgtactgtgagaatttcgcaccaggc
accaccaggcctggcccgcccccggtcagtcaaggtcagaggctgagcccgggttcttac
cccacagtcattcagcagcagaatgccacgagccaaagagccgccaaaaacggacccccg
gtcagtgaccaaaaggaagtattacctgcgggggtgaccattaaacaggagcagaacttg
gaccagacctacttggatgatgttaatgaaattatcaggaaggagttttcaggacctcct
gccagaaatcagacgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662672
Entry
104662672         CDS       T03989                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4 isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04625  C-type lectin receptor signaling pathway
rro04921  Oxytocin signaling pathway
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104662672 (NFATC4)
   04022 cGMP-PKG signaling pathway
    104662672 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104662672 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104662672 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104662672 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    104662672 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662672 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    104662672 (NFATC4)
   05161 Hepatitis B
    104662672 (NFATC4)
   05163 Human cytomegalovirus infection
    104662672 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104662672 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104662672 (NFATC4)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104662672 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 104662672
NCBI-ProteinID: XP_010362008
LinkDB
Position
5
AA seq 931 aa
MEALIRQGKRLPEGPGRVAPGRDLGAPAGSMGAASCEDEELEFKLVFGEEKEAPPLGAGG
LGEELDSEDAPPCCRLALGEPPPYGAAPIGIPRPPPPRPGMHSPPPRPAPSPGTWESQPA
RSVRLGGPGGGTGGAGGGRVLECPSIRITSISPTPEPPAALEDNPDTWGDGSPRDYPPPE
GFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEAASRFG
LGSPLPSPRASPRPWTPEDPWSLYGPSPGGRGPEDNWLLLSAPGPTPASPRPASPCGKRR
YSSSGTPSSASPALSRRGSLGEEGSEPPPPPPLPLARDPGSPGPFDYVGAPPAESIPQKT
RRTSSEQAVALPRSEEPAPCNGKLPLGAEESVAPPGGPRKEVAGMDYLAVPSPLAWSKAR
IGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHP
VVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATASYEAVVSGTKVLEMT
LLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQGGGKVVSVQA
ASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQW
EEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKFLPVICKE
EPLPDSSLRGFPSASAPPFGTDMDFSPPRPPYPSYPHEDPAYETPYLSEGFGYGMPPLYP
QTGPPPSYRPGLRMFPETRGTTGCAQPPPVSFLPRPFPSDPYGGRGSSFPLGLPFSPPAP
FRPPLPASPPLEGPFPSQSDVHPLPAEGYNKVGPGYGPGEGAPEQEKSRGGYSSGFRDSV
PIQGITLEEVSEIIGRDLSGFPAPPGDEPPA
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggaggcgctgattcggcagggcaaaagacttccagaaggcccgggcagagtagcccca
ggccgggacctgggggctcctgccggatccatgggggcggccagctgcgaggatgaggag
ctggaatttaagctggtgttcggggaggaaaaggaggcccccccgctgggcgcgggggga
ttgggggaagaactggactcagaggatgccccgccatgctgccgtctggccttgggagag
ccccctccctatggcgctgcacctatcggtattccccgacctccaccccctcggcctggc
atgcattcaccaccgccgcgcccagccccctcacctggtacctgggagagccagcccgcc
cggtcggtgaggctgggaggaccaggagggggtactgggggtgctgggggtggccgtgtt
ctcgagtgtcccagcatccgcatcacctccatctctcccacgccggagccgccggcggcg
ctggaggacaaccctgatacctggggggacggctctcctagagattaccccccaccagaa
ggctttggaggctaccgagaggcagggggccagggtgggggggccttcttcagcccaagc
cctggcagcagcagcctgtcctcctggagcttcttctccgatgcctctgacgaggcagcc
ctgtatgcagcctgcgacgaggtggagtctgagctaaatgaggcggcctcccgctttggc
ctgggctccccgctgccctcgcccagggcctcccctcggccatggacccccgaagatccc
tggagcctgtatggtccaagccccggaggccgagggccagaggataactggctactcctc
agtgctcctgggcccaccccagcctcccccaggcctgcctctccatgtggcaagcggcgc
tattccagctcgggaaccccatcttcagcctccccagctctgtcccgccgtggcagcctg
ggggaagaggggtctgagccacctccaccacccccattgcctctggcccgggatcctggc
tcccctggtccctttgactatgtgggggccccaccagctgagagcatccctcagaagacc
cggcggacttccagcgagcaggcggtggctctgcctcggtctgaggagcctgccccatgc
aatgggaagctgcccttgggagcagaggagtctgtggctcctccaggaggtccccggaag
gaggtggctggcatggactacctggcagtgccctccccactcgcttggtccaaggcccgg
attgggggacacagccctatattcaggacctctgccctacccccactggactggcctctg
cccagccaatatgagcagctggagctgaggatcgaggtacagccaagagcccaccaccgg
gcccactatgagacagaaggcagccgtggagctgtcaaagctgcccctggcggtcacccc
gtagtcaagctcctaggctacagtgagaagccactgaccctacagatgttcatcggcact
gcagatgaaaggaacctgcggcctcatgccttctatcaggtgcaccgtatcacaggcaag
atggtggccacagccagctatgaagccgtagtcagtggcaccaaggtgttggagatgact
ctgctgcctgagaacaacatggcggccaacattgactgtgcgggaatcctgaagcttcgg
aattcagacattgagcttcggaagggtgagacggacatcgggcgcaaaaatacacgtgtg
cgactggtgttccgggtacacgtgccccagggcggcgggaaggtcgtctcggtacaggca
gcgtcggtgcccatcgagtgctcccagcgctcagctcaggagctgccccaggtggaggcc
tacagccctagtgcctgctctgtgagaggaggtgaggaactagtactgactggctcgaac
ttcctgccggactccaaggtggtgttcattgagaggggtcctgatgggaagctgcaatgg
gaggaggaggccacagtgaaccgactgcagagcaacgaggtgacgctgaccttgactgtc
cctgagtacagcaacaagagggtgtcccggccagttcaggtctacttttacgtctccaat
gggcggaggaaacgcagtcctacccaaagtttcaagtttctgcctgtgatctgcaaagag
gagcccctaccggactcatctctgcggggcttcccttcagcatcggcacccccctttggc
actgacatggacttctcaccacccaggcccccctacccctcctatccccatgaagaccct
gcttacgaaactccttacctatcagaaggcttcggctatggcatgccccctctgtacccc
cagacggggcccccaccatcctacagaccgggcctgcggatgttccctgagactaggggt
accacaggttgtgcccaaccacctccagtctccttccttccccgccccttccctagtgac
ccctatggagggcggggctcctcttttcccctggggctgccattctctcctccagccccc
tttcggcctcctcttcctgcatccccaccgcttgaaggccccttcccttcccagagtgat
gtgcatcccctacctgctgagggatacaataaggtagggccaggctatggccctggggag
ggggctccggagcaggagaaatccaggggtggctacagcagcggcttccgagacagtgtc
cctatccagggtatcacgctggaggaagtgagtgagatcattggccgagacctgagtggc
ttccctgcacctcctggagatgagcctcctgcttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667797
Entry
104667797         CDS       T03989                                 

Gene name
NFATC1
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04921  Oxytocin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05135  Yersinia infection
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104667797 (NFATC1)
   04310 Wnt signaling pathway
    104667797 (NFATC1)
   04024 cAMP signaling pathway
    104667797 (NFATC1)
   04022 cGMP-PKG signaling pathway
    104667797 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104667797 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104667797 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    104667797 (NFATC1)
   04660 T cell receptor signaling pathway
    104667797 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    104667797 (NFATC1)
   04659 Th17 cell differentiation
    104667797 (NFATC1)
   04662 B cell receptor signaling pathway
    104667797 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104667797 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104667797 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104667797 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104667797 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104667797 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104667797 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104667797 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    104667797 (NFATC1)
   05161 Hepatitis B
    104667797 (NFATC1)
   05163 Human cytomegalovirus infection
    104667797 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104667797 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104667797 (NFATC1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104667797 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 104667797
NCBI-ProteinID: XP_030781638
LinkDB
Position
21
AA seq 937 aa
MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQ
TSTPGIVPPADHPAGYGAALDGGPAGYFLSSGHARPDGAPALESPRIEITSCLGLYHNNN
QFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNY
SYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLG
ARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIV
AAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDFSS
FQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPASYMSPTLPALDWQLPSHSGPYELRIEVQ
PKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLESEPLMLQLFIGTADDRLLRPHAFYQ
VHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAIIDCAGILKLRNSDIELRKGETDI
GRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVMGGKK
MVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVH
VSFYVCNGKRKRSQYQRFTYLPANVPMIKTEPTDDYEPAPNCGPVSQGLSPLPRPYYSQQ
LAMPPDPSSCLVAGFPPCPQRSTLMPAAPGASPKLHDLSPAAYTKGVASPGHCHLGLPQP
AGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSVPPSSSCPPGLEHSLCPSSPSPPLPP
AAQELTCLQPCSPACPPATGRPQHPPPTVRRDESPAARPRLLPEACEDGSPNLAPIPVTV
KQEPEELDQLYLDDEVTGDGEHHRCVGDSGTPPSKGK
NT seq 2814 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaccaggagttcgacttcgagtttctcttcgagtttaaccagcgc
gacgagggcgctgccgcggccgccccagaacactatggctatgcgtcctccaatgtcagc
cctgccttgccgctccccacagcacactccaccctgccggccccatgccacaaccttcag
acctccacaccgggcatcgtcccgccggcagatcaccccgcggggtacggagcagctttg
gacggtgggcccgcgggctacttcctctcctccggccacgccaggccagatggggcccct
gccctggagagtcctcgcatcgagataacctcatgcttgggtctgtaccacaacaacaac
cagtttttccacgatgtggaggtggaagacgtcctccccagctccaaacggtccccctcc
acggccacgctgagtctgcccagcctggaggcctacagagacccctcgtgcctgagcccg
gccagcagcctgtcctcccgcagctgcaactcagaggcctcctcctacgagtccaactac
tcgtacccgtacgcgtccccccagacgtcgccatggcagtctccctgcgtttctcccaag
accacggaccctgaggagggctttccccgcgggctgggggcctgcacgctgctgggttcc
ccgcggcactccccctccacctcgccccgtgccagcgtcactgaggagagctggctgggt
gcccgctcctccaggcccgcgtccccgtgcaacaagaggaagtacagcctcaacggccgg
cagccgccctactcaccccaccactcgcccacgccgtccccgcacggctccccgcgggtc
agcgtgaccgacgactcgtggttgggcaacaccacccagtacaccagctcggccatcgtg
gccgccatcaacgcgctgaccactgacagcagcctggacctgggtgacggcgtccctgtc
aagtcccgcaagaccaccctggagcagccgccctcggtggcgctcaaggtggaacccgtc
ggggaggacctgggcagccccccgcccccggccgacttcgcgcccgaagacttctcctct
ttccagcacatcaggaagggcggcttctgcgaccagtacctggcggtgccccagcaccca
taccagtgggcgaagcccaagcccctgtcccctgcgtcctacatgagcccaaccctgccc
gccctggactggcagctgccgtcccactcaggcccatacgagcttcggattgaggtgcag
cccaagtcccaccaccgagcccactatgagacggagggcagccggggggccgtgaaggcg
tcggctggaggacaccccatcgtgcagctccatggctacttggagagtgagccgctgatg
ctgcagcttttcatcgggacggcagacgaccgcctgctgcgcccacacgccttctaccag
gtgcaccgtatcacggggaagaccgtgtccaccaccagccacgaggccatcctctccaac
accaaagtcctggagatcccactcctgccggagaacagcatgcgagccatcattgactgt
gctggaatcctgaagctcagaaactccgacattgaacttcggaaaggagagacggacatt
gggaggaagaacacacgggtacggctggtgttccgtgttcacgtcccgcagcccagcggc
cgcacgctgtccctgcaggtggcctccaaccccatcgaatgttcccagcgctcggcccag
gagctgcccctggtggagaagcagagcaccgacagctacccggtcatgggagggaagaag
atggtcctgtcaggccacaacttcctgcaggactccaaggtcattttcgtggagaaagcg
ccagatggccaccacgtctgggagatggaagcgaaaaccgatcgtgacctgtgcaagccg
aattctctggtggttgagatcccgccatttcggaatcagaggataaccagccctgttcac
gtcagtttctacgtctgcaacgggaagagaaagcgaagccagtaccagcgtttcacctac
cttcccgccaacgttccaatgataaaaacagaacccacggatgattatgagcctgctcca
aactgtgggccggtgagccaggggttaagtcctctcccaagaccatactacagccagcag
ctcgcgatgccacctgaccccagctcctgcctcgtggccggcttcccgccctgtcctcag
agaagcaccctgatgccagcagcccctggtgcgagccccaagctccacgacctttctcct
gctgcctacaccaagggcgtcgccagcccgggccactgccacctcggactcccgcagccg
gccggagaggcccccgccgtccaggacgtgcccaggccagtggccacgcaccccggctcg
cccgggcagccgcccccggccctgctgccacagcaggtgagtgtgcctccaagcagtagc
tgcccccctggtctcgaacactcactctgccccagcagcccctctcctccactcccgccc
gccgcccaagagctgacctgcctgcagccctgcagcccagcgtgcccgcccgccacgggc
cgcccgcagcacccgccgcccacggtccgcagggatgagtctccggccgcccggccacgg
ctgctgccagaggcgtgtgaggacggtagtcctaatttggcccctattcctgtaacggtc
aagcaagagcctgaagagttggaccagttgtacctggatgacgaagtcacaggtgacggg
gaacatcaccggtgtgtgggggactcagggacaccgccgtccaaagggaaataa

DBGET integrated database retrieval system