KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655705
Entry
104655705         CDS       T03989                                 

Gene name
GABRA5
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04723  Retrograde endocannabinoid signaling
rro04727  GABAergic synapse
rro04742  Taste transduction
rro05032  Morphine addiction
rro05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104655705 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    104655705 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    104655705 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    104655705 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104655705 (GABRA5)
   05033 Nicotine addiction
    104655705 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104655705 (GABRA5)
Ion channels [BR:rro04040]
 Ligand-gated channels
  GABA-A
   104655705 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4887
Other DBs
NCBI-GeneID: 104655705
NCBI-ProteinID: XP_030786538
LinkDB
Position
5
AA seq 462 aa
MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVNGETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKREVILNKSANAFTAGKMSHPPNIPKEQTPAGMSNTTSASVKPSEEKTSESKKTYN
SISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggacaatggaatgttctctggttttatcatgatcaaaaacctccttctcttttgtatt
tccatgaacttatccagtcactttggcttttcacagatgccaaccagttcagtgaacggt
gagaccaatgacaacatcacgatatttaccaggatcttggatgggctcttggatggctat
gacaacagacttcggcccgggctgggagagcgcatcacccaggtgaggaccgacatctac
gtcaccagcttcggcccggtgtccgacacggaaatggagtacaccatagacgtgtttttc
cgacaaagctggaaagatgaaaggctccggtttaaggggcccatgcagcgcctccctctc
aacaacctccttgccagcaagatctggaccccagacacgttcttccacaacgggaagaag
tccatagcgcacaacatgaccacgcccaacaagctgctgcggctggaggacgacggcacc
ctgctgtacaccatgcgcttgaccatctctgccgagtgccccatgcagcttgaggacttc
ccgatggatgcgcacgcttgccctctgaaatttggcagctatgcctaccctaattctgaa
gtcgtctatgtctggaccaacggctccaccaagtctgtggtggtggcggaagatggctcc
agactgaaccagtaccacctgatggggcagacggtgggcactgagaacatcagcaccagc
acaggcgaatacacaatcatgacagctcacttccacctgaaaaggaagattggctacttt
gtcatccagacctaccttccctgcataatgaccgtgatcttatcacaggtgtccttctgg
ctgaaccgggaatcagtcccagccaggacagtttttggggtcaccacggtgctgaccatg
acgaccctcagcatcagcgcccggaactctctgcccaaagtggcctacgccaccgccatg
gactggttcatagccgtgtgctatgccttcgtcttctcggcgctgatagagtttgccacg
gtcaattactttaccaagagaggctgggcctgggatggcaaaaaagccttggaagcagct
aaaatcaagaaaaagcgtgaagtcatactaaataagtcagcaaatgcttttacagctggg
aagatgtctcaccccccaaacattccgaaggaacagactccagcagggatgtcgaacaca
acctcagcctcagtaaaaccctccgaagagaagacttctgaaagcaaaaagacttacaac
agtatcagcaaaattgacaaaatgtcccgaatcgtattcccagtcttgttcggcactttc
aacttagtgtactgggccacgtatttgaatcgggagccggtgataaaaggagctgcctct
ccaaaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658086
Entry
104658086         CDS       T03989                                 

Gene name
GABRA2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-2 isoform X2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04723  Retrograde endocannabinoid signaling
rro04727  GABAergic synapse
rro04742  Taste transduction
rro05032  Morphine addiction
rro05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104658086 (GABRA2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    104658086 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    104658086 (GABRA2)
  09157 Sensory system
   04742 Taste transduction
    104658086 (GABRA2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104658086 (GABRA2)
   05033 Nicotine addiction
    104658086 (GABRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104658086 (GABRA2)
Ion channels [BR:rro04040]
 Ligand-gated channels
  GABA-A
   104658086 (GABRA2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104658086
NCBI-ProteinID: XP_010356315
LinkDB
Position
2
AA seq 456 aa
MRLKITLPSLQEFLTDFWMVTIIGLDQDWEEYTIDVFFRQKWKDERLKFKGPMNILRLNN
LMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPM
DAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTG
EYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTT
LSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKSP
SIKAEGIILTYNSVKAILQRAKLICSKYIAFSWPSLFQERTLEYLEKWMDCLTFRESSKK
EKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVS
KIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVSP
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaggctaaaaataacattaccatctttacaagaattcttgacagacttctggatggtt
acgataatcggcttagaccaggactgggaggaatatacaattgatgttttctttcgacaa
aaatggaaagatgaacgtttaaaatttaaaggtcctatgaacatccttcggctaaacaat
ttaatggctagcaaaatctggactccagataccttttttcacaacgggaaaaaatcagta
gctcataatatgacaatgccaaataagttacttcgaattcaggatgatgggactctgctg
tatacaatgaggcttacagttcaagctgaatgcccaatgcacttggaggatttcccaatg
gatgctcattcatgtcctctgaaatttggcagttatgcatatacaacttcagaggtcact
tatatttggacttacaatgcatctgattcagtacaggttgctcctgatggctctaggtta
aatcaatatgatctgctgggccaatcaattggaaaggagacaattaaatctagtacaggt
gaatacactgtaatgacagctcatttccacttgaaaagaaaaattgggtattttgtgatt
cagacatatctgccttgcatcatgactgtcattctctcccaagtttcattctggcttaac
agagaatctgtgcctgcaagaactgtgtttggagtaacaactgtcctaacaatgacaact
ctaagcatcagtgctcggaattctctccccaaagtggcttatgcgactgccatggactgg
tttattgctgtttgttatgcatttgtgttctctgccctaattgaatttgcaactgttaat
tacttcaccaaaagaggatgggcttgggatgggaagagtgtagtaaatgacaagtcccct
tcaataaaagctgaaggcattatattaacatacaactcagtgaaagcaattcttcaacga
gctaagctaatatgttccaagtatatagctttctcatggcccagtttattccaagaaagg
actttagagtacttagagaagtggatggactgtttaaccttcagagaatcttctaaaaaa
gaaaaggcttccgttatgatacagaacaatgcttatgcagtggctgttgccaattatgcc
ccgaacctttcaaaagatccagttctttccaccatctccaagagcgcaaccacgccagaa
cccaacaagaagccagaaaacaagccagctgaagccaagaaaacttttaacagtgttagc
aaaattgacagaatgtccagaatagtttttccagttttgtttggtacatttaatttagtt
tactgggctacatatttaaacagagaacctgtattaggggtcagtccttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680072
Entry
104680072         CDS       T03989                                 

Gene name
GABRA4
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-4 isoform X1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04723  Retrograde endocannabinoid signaling
rro04727  GABAergic synapse
rro04742  Taste transduction
rro05032  Morphine addiction
rro05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104680072 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    104680072 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    104680072 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    104680072 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104680072 (GABRA4)
   05033 Nicotine addiction
    104680072 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104680072 (GABRA4)
Ion channels [BR:rro04040]
 Ligand-gated channels
  GABA-A
   104680072 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 104680072
NCBI-ProteinID: XP_010384169
UniProt: A0A2K6RII0
LinkDB
Position
2
AA seq 554 aa
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTSALVHSESDVGNRTVVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSSRTGYVSRKASVASASTRHMFG
SRLQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtttctgccaagaaggtacccgcgatcgctctgtccgccggggtcagtttcgccctc
ctgcgcttcctgtgcctggcggtttgtttaaacgaatccccaggacagaaccaaaaggag
gagaaattgtgcacagaaaatttcacccgcatcctggacagtttgctcgatggttatgac
aacaggctgcgtcctggatttgggggtcctgttacagaagtgaaaactgacatatatgtc
accagcttcggacctgtttctgatgttgaaatggaatatacaatggatgtgttcttcaga
cagacatggattgacaaaagactaaaatatgatggtcccattgaaattttgagattgaac
aatatgatggtaacaaaagtatggacccctgatactttcttcaggaatggaaagaaatct
gtctcacataatatgacagctccaaataagctttttagaattatgagaaatggtactatt
ttatacacaatgagactcaccataagtgcggagtgtcccatgagattggtggattttccc
atggatggtcatgcatgccctttgaaattcgggagttatgcctatccaaagagtgagatg
atctacacctggacaaaaggtcctgagaaatcagttgaagttccgaaggagtcttccagc
ttagttcaatatgatttgattgggcaaaccgtatcaagtgaaaccatcaaatcgattacg
ggtgaatatattgttatgacggtttacttccacctcagacggaagatgggttattttatg
attcagacctatattccatgcattatgacagtgattctttctcaagtttcattctggata
aataaagaatcagttcccgctaggactgtatttggaataacaactgtcctcaccatgacc
acactaagcatcagtgcacgacattctttgcccaaagtgtcctatgctactgccatggat
tggttcatagctgtctgctttgcttttgtattttcggcccttatcgagtttgctgctgtc
aactatttcaccaatatccaaatggaaaaagccaaaaggaagacatcaaagccccctcag
gaagttcccgctgctccagtgcagagagagaagcatcctgaagcccctctgcagaataca
aatgccaatttgaacatgagaaaaagaacaagtgctttggttcactctgaatctgacgtt
ggcaacagaactgtggtgggaaaccattcaagcaaatcttccacagttgttcaagaatct
tctaaaggcacacctcggtcttacttagcttccagtccaaacccattcagccgtgcaaat
gcagctgaaaccatatctgcggcaagagcacttccatctgcttctcctacttctagccga
actggatatgtgtctcgaaaggcttcagttgcatctgcttctactcgtcacatgtttgga
tcaagattgcagaggattaagaccacagttaataccataggggctactgggaagttgtca
gctactcctcctccatcagctccaccaccttctggatctggcacaagtaaaattgacaaa
tatgcccgtattctctttccagtcacatttggggcatttaacatggtttattgggttgtt
tatttatctaaggacactatggagaaatcagaaagtctaatgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682337
Entry
104682337         CDS       T03989                                 

Gene name
GABRA6
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-6 isoform X2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04723  Retrograde endocannabinoid signaling
rro04727  GABAergic synapse
rro04742  Taste transduction
rro05032  Morphine addiction
rro05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104682337 (GABRA6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    104682337 (GABRA6)
   04723 Retrograde endocannabinoid signaling
    104682337 (GABRA6)
  09157 Sensory system
   04742 Taste transduction
    104682337 (GABRA6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104682337 (GABRA6)
   05033 Nicotine addiction
    104682337 (GABRA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104682337 (GABRA6)
Ion channels [BR:rro04040]
 Ligand-gated channels
  GABA-A
   104682337 (GABRA6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb Foie-gras_1 DUF4396
Other DBs
NCBI-GeneID: 104682337
NCBI-ProteinID: XP_010387219
UniProt: A0A2K6PBN6
LinkDB
Position
3
AA seq 453 aa
MALPLPWLCIILWLESALGKLEDEGNFYSENISRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFRGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQIAAPPTVTISKATEPLEAEI
ILHPDSKYHLKKRITSLSLPIVSSSEASKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY
SRILFPVAFAGFNLVYWIVYLSKDTMEMSSSAE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcgttgcctctgccctggctgtgcattattctgtggctagaaagtgccctagggaaa
ctcgaagatgaaggcaacttctactcagaaaacatcagtcggatcctggacaacttgctt
gaaggctatgacaatcggctgcggccgggatttggaggtgctgtcactgaagtcaaaaca
gacatttatgtgaccagttttgggcctgtgtcagatgtggagatggagtatacgatggat
gtttttttccgccagacttggacagatgagaggttgaagtttagggggccaactgagatt
ctgagtttgaataacttgatggtcagtaaaatctggacgcctgacacttttttcagaaat
ggtaaaaagtcaattgcacacaacatgacaactcctaataaactcttcagaataatgcag
aatggaaccattttatataccatgaggcttaccatcaatgccgattgtcccatgaggctg
gttaactttcctatggatgggcatgcttgtccactcaagtttgggagctatgcttatccc
aaaagtgaaatcatatatacatggaaaaaaggaccactttactcagttgaagtcccagaa
gaatcttcaagccttctccagtatgatctgattggacaaacagtatctagtgagacaatt
aaatctaacacaggtgaatacgttataatgacagtttacttccacttgcaaaggaagatg
ggctacttcatgatacagatatacactccttgcattatgacagtcattctttcccaggtg
tctttctggattaataaagagtccgtcccagcaagaactgtttttgggatcaccactgtt
ttaactatgaccactttgagcattagtgcccggcactctttgccaaaagtgtcatatgcc
actgccatggattggttcatagctgtttgctttgctttcgtcttctctgctcttatcgag
tttgcagcggtcaactactttaccaatcttcagacacagaaggccaaaaggaaggcacag
attgcagccccacccacagtgacaatatcaaaagctactgaacctttggaagctgagatt
attttgcatcctgactccaaatatcatctgaagaaaagaatcacttctctgtccttgcca
atagtttcatcttctgaggccagtaaagtgctcactagagcgcccattctacaatcaaca
cctgtcacgcccccaccactctctccagcctttggaggcaccagtaaaatagaccagtat
tctcgaattctcttcccagttgcatttgcaggattcaaccttgtatactggatagtttat
ctttccaaagatacaatggaaatgagtagcagtgctgaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682346
Entry
104682346         CDS       T03989                                 

Gene name
GABRA1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04723  Retrograde endocannabinoid signaling
rro04727  GABAergic synapse
rro04742  Taste transduction
rro05032  Morphine addiction
rro05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104682346 (GABRA1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    104682346 (GABRA1)
   04723 Retrograde endocannabinoid signaling
    104682346 (GABRA1)
  09157 Sensory system
   04742 Taste transduction
    104682346 (GABRA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104682346 (GABRA1)
   05033 Nicotine addiction
    104682346 (GABRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104682346 (GABRA1)
Ion channels [BR:rro04040]
 Ligand-gated channels
  GABA-A
   104682346 (GABRA1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104682346
NCBI-ProteinID: XP_010387241
UniProt: A0A2K6RHI0
LinkDB
Position
3
AA seq 456 aa
MRKSPGLSDYLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaggaaaagtccaggtctgtctgactatctttgggcctggatcctccttctcagcacg
ttgactggaagaagctatgggcagccatcattacaagatgaacttaaagacaataccact
gtcttcaccaggattttggacagactcctagatggttatgacaatcgcctgagaccagga
ttgggagagcgtgtaaccgaagtgaagactgatatcttcgtcaccagttttggacccgtt
tcagaccatgatatggaatatacaatagatgtatttttccgtcaaagctggaaggatgaa
aggttaaaatttaaagggcccatgacagtcctccggttaaataacctaatggcaagtaaa
atctggactccggacacattttttcacaatggaaagaagtcagtggcccacaacatgacc
atgcccaacaaactcctgcggatcacagaggatggcaccttgctgtacacaatgaggctg
acagtgagagctgaatgtccaatgcatttggaggacttccctatggatgcccatgcttgc
ccactaaaatttggaagctatgcttatacaagagcagaagttgtttatgaatggaccaga
gagccagcacgctcagtggttgtagcagaagatggatcacgtctaaaccagtatgatctt
cttggacaaacagtagactctggaattgtccagtcaagtacaggagaatatgttgttatg
accactcatttccacttgaagagaaagattggctactttgttattcaaacatacctgcca
tgcataatgacagtgattctctcacaagtgtccttctggctcaacagagagtctgtacca
gcaagaactgtctttggagtaacaactgtgctcaccatgacaacgctaagcatcagtgcc
agaaactccctccctaaggtggcttatgcaacagctatggattggtttattgcagtgtgc
tatgcctttgtgttctcagctctgattgagtttgccacagtaaactatttcaccaagaga
ggttatgcatgggatggcaaaagtgtggttccagaaaagccaaagaaagtaaaggatcct
cttattaagaaaaacaacacttatgctccaacagcaaccagctacacccctaatctggcc
aggggtgacccaggcttagccaccattgctaaaagtgcaaccatagaacccaaagaggtc
aagcccgaaacaaaaccaccagaacccaagaaaacctttaacagtgtcagcaaaattgac
cgactgtcaagaatagccttcccgctgctatttggaatctttaacttagtctactgggct
acgtatttaaacagagagcctcagctaaaagcccccacaccacatcaatag

DBGET integrated database retrieval system