KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655775
Entry
104655775         CDS       T03989                                 

Gene name
PAK5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05170  Human immunodeficiency virus 1 infection
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104655775 (PAK5)
   04014 Ras signaling pathway
    104655775 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655775 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104655775 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104655775 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    104655775 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104655775 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104655775 (PAK5)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104655775 (PAK5)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE20 family
   104655775 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 104655775
NCBI-ProteinID: XP_010353574
UniProt: A0A2K6R6C8
LinkDB
Position
13
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEMKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPAMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKAGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcacactgggtttgatccacaagagcagaagtttaccggccttccccagcaatggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggatccttcgtgcatcaca
cccatccagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggattttgacaacatctcggtgactcgttccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgcg
gaagaaaatggcttcatcaccttctcccagtattccagcgaatccgatactactgctgac
tacacgaccgaaaagtacagggagaagagtctctatggagacgatctggatccatattat
agaggcagccatgcagccaaacaaaatgggcacgtaatgaaaatgaagcacggggaggcc
tactattctgagatgaagcctttgaaatccgattttgccagattttctgctgattatcac
tcacatttggactcactgagcaaaccaagtgaatatagtgacctcaagtgggagtatcag
agagcctccagtagctcccctctggattattcattccaattcacaccttctagaactgca
gggaccagtgggtgctccaaggagagcttggcgtacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccgaagtcttcgtacctgaatcagaccagcccccagccc
gccatgcggcagaggtccaggtcaggctcggggctccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattatgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaagcgggctattcctcaagcagccaccagtatccgtctgggtaccacaaagcc
accttgtaccaccacccctccctgcagagcagttcgcagtacatctccacggcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggttcctcctcc
gaccagcagccctccagggtgtcccatgaacagtttcgggcagccctgcagctggtggtc
agcccaggagaccccagggaatacttggacaactttatcaaaattggggaaggctcaacc
ggcatcgtgtgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgggaactgcttttcaatgaggtcgtgatcatgcgggat
taccaccatgacaatgtggttgacatgtacaatagctaccttgttggcgatgagctctgg
gtggttatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagtgatggc
cggataaagttatctgattttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtcccttgggatcatggtgatagaaatgatcgatggtgag
cccccctacttcaacgagcctcccctccaggcgatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggattcctagacctgatg
ttggtgagggagccctctcagagagcaacggcccaggaactcctcggacatccattctta
aaactagcaggtccaccatcttgcatcgtccccctcatgagacaatacaggcatcactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659671
Entry
104659671         CDS       T03989                                 

Gene name
PAK6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05170  Human immunodeficiency virus 1 infection
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104659671 (PAK6)
   04014 Ras signaling pathway
    104659671 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104659671 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104659671 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104659671 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    104659671 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104659671 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104659671 (PAK6)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104659671 (PAK6)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE20 family
   104659671 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 104659671
NCBI-ProteinID: XP_010358078
UniProt: A0A2K6R5S0
LinkDB
Position
5
AA seq 681 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAVPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTATGRRGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTQESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTLDTSSPQKSLRTAAAAGPLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagccccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggccttcccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcggtgcctgtggatggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgcggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagtccccagtctgagcgcaccgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgaatttcagggtgcctcacagcgctgtctgcagctgggtgcttgcctgcag
agctccccaccaggagcctcaccccccacagccactggtaggcgtggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccaggagagcagcctgaagcgtaggcta
ttccgaagcatgttcctgtccactgctgccacggcccctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcctctttccgaccaccacagaaagacaaccctcca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccactttggataccagcagcccccagaagtccctccgcacagccgcggccgcaggc
ccgcttccaggccggtcttccccagcaggttccccccgcacctggcatgcccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggcgctctggctggtgag
gacacaggtgttgtgacacatgagcagttcaaggctgcactcaggatggtggtggaccag
ggtgacccccggctgttgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgtttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagttgctcttcaatgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctagtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgaa
gagcagatcgccactgtgtgtgaggctgtgctgcaggccctggcttacctgcatgcccag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctggatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtggatggggagccaccc
tacttcagtgactccccggtgcaagccatgaagaggctccgggacagccccccgcccaag
ctgaaaaactctcacaaggtctccccagtactgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctacccgagtgcctggtgcccctgatccagctctaccgcaagcagacctccacc
tgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664316
Entry
104664316         CDS       T03989                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1 isoform X5
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04360  Axon guidance
rro04392  Hippo signaling pathway - multiple species
rro04510  Focal adhesion
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04810  Regulation of actin cytoskeleton
rro05132  Salmonella infection
rro05170  Human immunodeficiency virus 1 infection
rro05205  Proteoglycans in cancer
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104664316 (PAK1)
   04012 ErbB signaling pathway
    104664316 (PAK1)
   04014 Ras signaling pathway
    104664316 (PAK1)
   04392 Hippo signaling pathway - multiple species
    104664316 (PAK1)
   04024 cAMP signaling pathway
    104664316 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104664316 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104664316 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104664316 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    104664316 (PAK1)
   04660 T cell receptor signaling pathway
    104664316 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    104664316 (PAK1)
   04062 Chemokine signaling pathway
    104664316 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    104664316 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104664316 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104664316 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104664316 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104664316 (PAK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104664316 (PAK1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE20 family
   104664316 (PAK1)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    104664316 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    104664316 (PAK1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104664316 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 104664316
NCBI-ProteinID: XP_010364087
UniProt: A0A2K6RTM5
LinkDB
Position
15
AA seq 545 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTSTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccggcccctccgatgagaaatacc
agcactatgattggagctggcagcaaagatactggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgttggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcaaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattataattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccgccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcacttcaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgcg
tcaggcaccgtgtacactgcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagcta
tgggttgttatggaatacttggctggaggctccttgacagacgtagtgacagaaacatgc
atggatgaaggccagattgcagctgtgtgccgtgagtgtctgcaggctctggagtttttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgattttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtgggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtcttgagatggatgtggagaagagaggttcagctaaagagctgctgcagcatcagttc
ctgaagattgccaagcccctctctagcctcactccactgattgctgcagcaaaggaggca
acaaagaacaatcactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668306
Entry
104668306         CDS       T03989                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05132  Salmonella infection
rro05170  Human immunodeficiency virus 1 infection
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104668306 (PAK3)
   04014 Ras signaling pathway
    104668306 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104668306 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104668306 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104668306 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    104668306 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104668306 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104668306 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104668306 (PAK3)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104668306 (PAK3)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE20 family
   104668306 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N DSHCT APH Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 104668306
NCBI-ProteinID: XP_030790322
LinkDB
Position
7
AA seq 544 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEE
EEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIK
NSSR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctgacggtctagataatgaagagaaacccccagctcccccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactggaattcccgagcaatgggcacga
ttactccaaacctccaacataacaaaattggaacagaagaagaacccccaagctgttcta
gatgttctcaaattctatgattccaaagaaacagtcaacaaccagaaatacatgagcttt
acatcaggagataaaagtgcacatggatacatagcagcccatccttcgagtacaaaaaca
gcatctgagcctccattggcccctcctgtgtctgaagaagaagatgaagaggaggaagaa
gaagaagatgacaatgagccaccaccagttatcgcaccaagaccagagcatacaaaatca
atctacactcgttctgtggttgaatccattgcttcaccagcagcaccaaataaagaggtc
acaccaccctctgctgaaaatgccaattccagtactttgtacaggaacacagatcggcaa
agaaaaaaatccaagatgacagatgaggagatcttagagaagctaagaagcattgtgagt
gttggggacccaaagaaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggt
actgtttatacagcactagacattgcaacaggacaagaggtggccataaagcagatgaac
cttcaacagcaacccaagaaggaattaattattaatgaaattctggtcatgagggaaaat
aagaaccctaatattgttaattatttagatagctacttggtgggtgatgaactatgggta
gtcatggaatacttggctggtggctctctgactgatgtggtcacagagacctgcatggat
gaaggacagatagcagctgtctgcagagagtgcctgcaagctttggatttcttgcactca
aaccaggtgatccatagagatataaagagtgacaatattcttctcgggatggatggctct
gttaaattgactgactttgggttctgtgcccagatcactcctgagcaaagtaaacgaagc
actatggtgggaaccccatattggatggcacctgaggtggtgactcgaaaagcttatggt
ccgaaagttgatatctggtctctgggaattatggcaattgaaatggtggaaggtgaaccc
ccttaccttaatgaaaatccactcagggcattgtatctgatagccactaatggaacccca
gagctccagaatcccgagagactgtcggctgtattccgtgactttttaaatcgctgtctt
gagatggatgttgataggcgaggatctgccaaggagcttttgcagcatccatttttaaaa
ttagccaagcctctctccagcctgactcctctgattatcgctgcaaaggaagcaattaag
aacagcagccgctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676163
Entry
104676163         CDS       T03989                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4 isoform X1
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05170  Human immunodeficiency virus 1 infection
rro05206  MicroRNAs in cancer
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104676163 (PAK4)
   04014 Ras signaling pathway
    104676163 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104676163 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104676163 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104676163 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    104676163 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104676163 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104676163 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104676163 (PAK4)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104676163 (PAK4)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE20 family
   104676163 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 104676163
NCBI-ProteinID: XP_010379227
LinkDB
Position
12
AA seq 597 aa
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSQGRIASHSEAGGGSGDRRRVGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPTRNPAAPAAPATPTVPGPPGPRSPQR
EPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDL
RKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNE
EQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKS
LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPR
LKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgc
gtacacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcagctcgccggccaaagcccctcatcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gccctcacgctgctgctggatgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggatgccggaggag
ccggccaccacggccagagggggcccggggaaggcaggcagccaaggccggatcgccagt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggtggggccagagaagaggccc
aagtcttccagggagggctcaggggggccccaggagtcctcccgggacaaacgccccctc
tccgggcctgacgtcggcaccccccagcctgctggtctggccagtggggcgaaattggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcacgacgtggcccccaacgggccatcagcggggggcctggccatcccc
cagtcctcctcttcctcctcccggcctcccacccgagcccgaggtgcccccagccctgga
gtgctgggcccccacgcctcggagccccagctggcccctccaacccgcaacccagccgcc
cctgctgcccctgccacccctactgtgcccgggccccctggcccccgctcgccacagcgg
gagccgcagcgagtatcccatgagcagttccgggctgccctgcagctggtggtggaccca
ggtgacccccgctcctacctggacaacttcatcaagattggcgaggggtccacgggcatt
gtgtgcatcgccaccgtgcgcagctcgggcaagcttgtggccgtcaagaagatggacctg
cgcaagcagcagaggcgcgagctgctcttcaacgaggtggtgatcatgagggactaccag
cacgagaatgtggtggagatgtacaacagctacctggtgggggacgagctctgggtggtc
atggagttcctggaaggaggcgccctcaccgacatcgtcacccacaccaggatgaacgag
gagcagatcgcggccgtgtgcctggcagtgctgcaggccctgtcagtgctgcacgcccag
ggcgtcatccaccgggacatcaagagcgactcgatcctgctgacccatgatggcagggtg
aagctgtcagacttcgggttctgtgcccaggtgagcaaggaagtgccccgaaggaagtcg
ctggtcggcacgccctactggatggccccagagctcatctcccgccttccctatgggcca
gaggtggacatctggtcgctggggataatggtgattgagatggtggacggagagcccccc
tacttcaacgagccacccctcaaagccatgaagatgattcgggacaacttgccgccccga
ctgaagaacctacacaaggtgtcaccatccctgaagggcttcctggaccgcctgctagtg
cgggaccctgcgcagcgggccacggcagctgagctgctgaagcacccattcctggccaag
gcagggccgcccgccagcatcgtgcccctcatgcgccagaaccgcaccagatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676374
Entry
104676374         CDS       T03989                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05170  Human immunodeficiency virus 1 infection
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676374 (PAK2)
   04012 ErbB signaling pathway
    104676374 (PAK2)
   04014 Ras signaling pathway
    104676374 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104676374 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104676374 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104676374 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    104676374 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104676374 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104676374 (PAK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104676374 (PAK2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE20 family
   104676374 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 104676374
NCBI-ProteinID: XP_010379484
UniProt: A0A2K6NQV1
LinkDB
Position
1
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTETPAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSNVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagacccgttgtcagccaatcacagtttgaaacctttg
ccctctgttccggaggagaagaagcccaggcacaagatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gaacacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctgaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagacggcttcccttctggaacaccagcactgaacgccaag
ggaacagaaacaccggcagtagtgacagaggaagatgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcaaatgttgatggtggtgccaagtcttcagacaaa
cagaaaaagaagactaaaatgacagatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagtttttactgctactgacgttgcattgggacaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttaccttgtaggagatgaattgttt
gtggtcatggagtaccttgctggtggatcgctcactgatgtggtaacggaaacgtgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtacttttgggaatggaagga
tcggttaagctcactgacttcggtttctgtgcccagatcacccccgagcagagcaaacgc
agtaccatggtcggaaccccgtactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagagaaactttctccaatatttcgagatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcccttcttg
aaactggccaaaccattatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

DBGET integrated database retrieval system