KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655777
Entry
104655777         CDS       T03989                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04062  Chemokine signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04621  NOD-like receptor signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Module
rro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104655777 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104655777 (PLCB4)
   04310 Wnt signaling pathway
    104655777 (PLCB4)
   04371 Apelin signaling pathway
    104655777 (PLCB4)
   04020 Calcium signaling pathway
    104655777 (PLCB4)
   04070 Phosphatidylinositol signaling system
    104655777 (PLCB4)
   04072 Phospholipase D signaling pathway
    104655777 (PLCB4)
   04071 Sphingolipid signaling pathway
    104655777 (PLCB4)
   04022 cGMP-PKG signaling pathway
    104655777 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104655777 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104655777 (PLCB4)
   04613 Neutrophil extracellular trap formation
    104655777 (PLCB4)
   04621 NOD-like receptor signaling pathway
    104655777 (PLCB4)
   04062 Chemokine signaling pathway
    104655777 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    104655777 (PLCB4)
   04922 Glucagon signaling pathway
    104655777 (PLCB4)
   04929 GnRH secretion
    104655777 (PLCB4)
   04912 GnRH signaling pathway
    104655777 (PLCB4)
   04915 Estrogen signaling pathway
    104655777 (PLCB4)
   04921 Oxytocin signaling pathway
    104655777 (PLCB4)
   04926 Relaxin signaling pathway
    104655777 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    104655777 (PLCB4)
   04918 Thyroid hormone synthesis
    104655777 (PLCB4)
   04919 Thyroid hormone signaling pathway
    104655777 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    104655777 (PLCB4)
   04916 Melanogenesis
    104655777 (PLCB4)
   04924 Renin secretion
    104655777 (PLCB4)
   04925 Aldosterone synthesis and secretion
    104655777 (PLCB4)
   04927 Cortisol synthesis and secretion
    104655777 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104655777 (PLCB4)
   04270 Vascular smooth muscle contraction
    104655777 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    104655777 (PLCB4)
   04971 Gastric acid secretion
    104655777 (PLCB4)
   04972 Pancreatic secretion
    104655777 (PLCB4)
   04973 Carbohydrate digestion and absorption
    104655777 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104655777 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    104655777 (PLCB4)
   04725 Cholinergic synapse
    104655777 (PLCB4)
   04728 Dopaminergic synapse
    104655777 (PLCB4)
   04726 Serotonergic synapse
    104655777 (PLCB4)
   04720 Long-term potentiation
    104655777 (PLCB4)
   04730 Long-term depression
    104655777 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    104655777 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    104655777 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    104655777 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104655777 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655777 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104655777 (PLCB4)
   05016 Huntington disease
    104655777 (PLCB4)
   05017 Spinocerebellar ataxia
    104655777 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    104655777 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104655777 (PLCB4)
   04934 Cushing syndrome
    104655777 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104655777 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104655777 (PLCB4)
   05142 Chagas disease
    104655777 (PLCB4)
   05143 African trypanosomiasis
    104655777 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104655777 (PLCB4)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104655777 (PLCB4)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104655777 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104655777 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 104655777
NCBI-ProteinID: XP_010353580
LinkDB
Position
13
AA seq 1222 aa
MAGKKGREEKEVLNIIMAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEF
GFFLTWKSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGI
DLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKI
PVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIED
LFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKK
GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVE
MYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPV
ILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKR
LKPEVEKKQLEALRSMMEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADD
LGHKEAVANSVKKASDDLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYA
QPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSS
NYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSE
TPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY
NEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLP
TIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKN
DKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHL
KKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCL
EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKK
LLISAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNS
SNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEFLEQQNEQLLKSCHAVSQSQGEGDAAD
GEIGSRDGPQTSNSSMKLQNAN
NT seq 3669 nt   +upstreamnt  +downstreamnt
atggcagggaagaagggaagggaagaaaaggaggtcttgaatataatcatggccaaacct
tatgaatttaactggcagaaggaagttccttcctttttgcaagaaggagcagtttttgac
agatacgaagaggaatcctttgtgtttgaacccaactgcctcttcaaagtggatgagttt
ggcttctttctgacatggaaaagtgaaggcaaggaaggacaggtgctagaatgctccctc
atcaacagtattcggtcaggagccataccaaaggatcccaaaatcttggctgctcttgaa
gctgttggaaaatcagaaaatgatctcgaaggtcgaatagtttgtgtctgcagtggcata
gatctagtgaacattagttttacctacatggtggctgaaaatccagaagtaactaagcaa
tgggtagaaggcctgagatcaatcatacacaacttcagggccaacaatgtcagtccaatg
acgtgcctcaagaaacactggatgaaattggcatttatgaccaacacaaatggtaaaatt
ccagttaggagtattactagaacctttgcatcggggaaaacagaaaaggtgatctttcaa
gcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgagcccacggcattt
acttatgaaaagttctatgaactgacacaaaagatttgtcctcggacagatatagaagat
cttttcaaaaaaatcaatggagacaaaactgattatttaacggtagaccaattagtgagc
tttctaaatgaacatcaacgagatcctcgattgaatgaaattttatttccattttatgat
gccaaaagggcaatgcagatcattgagatgtatgaacctgatgaagatttgaagaaaaaa
ggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaaaatgccccagtc
ttcctagatcgtttagaactttaccaagaaatggaccatcctctggctcactacttcatc
agttcttcccataacacttatctgactggcagacagtttggtgggaagtcttcggtagaa
atgtacagacaggttctcctggctggttgcagatgtgttgaacttgactgctgggatgga
aaaggtgaagaccaagaaccaataataactcatgggaaagcaatgtgtacagatatcctt
tttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatcagaatatcctgta
attctctcctttgaaaatcactgcagcaaatatcaacagtacaagatgtccaaatattgc
gaagatctatttggggatctcctgttgaaacaagcgcttgaatcacatccacttgaacca
ggcaggcctttgccatcccccaatgacctcaaaagaaaaatactcataaaaaacaagcgg
ctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatgatggaagctgga
gaatctgcctccccagcaaacatcttagaggatgataatgaagaggagatcgaaagtgct
gaccaagaggaggaagctcaccccgaattcaaatttggaaatgaactttctgctgatgac
ttgggtcacaaggaagctgttgcaaatagcgtcaagaaggcctcagatgaccttgaacat
gaaaacaacaaaaagggtctggtaactgtagaagatgagcaggcatggatggcatcttat
aaatatgtaggtgctaccactaatatccatccatatttgtccacaatgatcaactacgcc
cagcctgtaaagtttcaaggtttccatgtggcagaagaacgcaatattcattataacatg
tcttcttttaatgaatcagtcggtcttggctacttgaagacacatgcaattgaatttgtc
aattataacaaacggcaaatgagtcgcatttaccccaagggaggccgagtggattccagt
aattatatgcctcagattttctggaacgctggctgccagatggtttcgctgaactatcaa
accccagatttagcgatgcaattgaatcagggaaaatttgagtataatggatcgtgcggg
taccttctcaaaccagatttcatgaggcggcctgatcgaacatttgaccccttctctgaa
actcctgttgatggcgttattgcagccacttgctcagtgcaggttatatcaggtcaattc
ttatcagataagaaaattggcacctatgtagaagtggatatgtatgggttgcccactgac
accatacgtaaggaattccgaactcgtatggttatgaataatggactaaatccagtttac
aatgaagagtcatttgtatttcggaaggtgatcctgccagacctggctgtcttgagaata
gcagtgtatgatgataacaacaagctgattggccagaggatcctcccacttgatggcctc
caagcaggataccgacacatttcccttcgaaatgagggaaataaaccattatcactgcca
acaattttctgcaatattgttcttaaaacatacgtgcctgatggatttggagatattgtg
gatgctttatcagatccaaagaaatttctctcaattacagaaaagagagcagaccaaatg
agagctatgggaattgaaactagtgacatagccgatgtgcccagtgacacttccaaaaat
gacaagaaaggaaaggccaacaccgccaaagcaaacgtgacccctcagagtagctctgag
ctcagaccaaccaccacagctgccctggcctctggtgtggaagccaagaaaggtattgaa
cttatccctcaagtaaggatagaagatttaaagcagatgaaggcttacttgaagcattta
aagaaacagcagaaagagctaaattctttaaagaagaaacatgcaaaggagcacagtacc
atgcagaagctacactgcacgcaagttgacaaaattgtggcacagtatgacaaagagaag
tcgactcatgagaaaatcctagagaaggcaatgaagaagaaagggggaagtaattgtctt
gaaatgaaaaaagaaacagaaattaaaattcagacgctgacatcagatcacaaatctaag
gtcaaagagattgtagcacagcacacaaaggaatggtcagaaatgatcaatacccacagt
gctgaggagcaagaaatccgagacctgcatctcagccagcagtgtgagctgctgaaaaag
ctactcatcagtgcccacgagcaacaaacccagcagctgaaactgtcccatgacagggaa
agcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagcaaagccatcagc
caagataaatctatcaagaataaggcagaacgggaaaggcgagtcagggagttaaacagc
agcaacactaaaaagtttctggaagaaagaaagagactcgcaatgaagcagtccaaagaa
atggatcagttgaaaaaagtccagcttgaacatctagaattcctagagcaacagaatgag
cagcttttgaaatcctgtcatgcagtgtcccaatcgcaaggcgaaggagatgcagcagat
ggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatgaaactccaaaat
gcaaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659669
Entry
104659669         CDS       T03989                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04062  Chemokine signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04621  NOD-like receptor signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Module
rro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104659669 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104659669 (PLCB2)
   04310 Wnt signaling pathway
    104659669 (PLCB2)
   04371 Apelin signaling pathway
    104659669 (PLCB2)
   04020 Calcium signaling pathway
    104659669 (PLCB2)
   04070 Phosphatidylinositol signaling system
    104659669 (PLCB2)
   04072 Phospholipase D signaling pathway
    104659669 (PLCB2)
   04071 Sphingolipid signaling pathway
    104659669 (PLCB2)
   04022 cGMP-PKG signaling pathway
    104659669 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104659669 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104659669 (PLCB2)
   04613 Neutrophil extracellular trap formation
    104659669 (PLCB2)
   04621 NOD-like receptor signaling pathway
    104659669 (PLCB2)
   04062 Chemokine signaling pathway
    104659669 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    104659669 (PLCB2)
   04922 Glucagon signaling pathway
    104659669 (PLCB2)
   04929 GnRH secretion
    104659669 (PLCB2)
   04912 GnRH signaling pathway
    104659669 (PLCB2)
   04915 Estrogen signaling pathway
    104659669 (PLCB2)
   04921 Oxytocin signaling pathway
    104659669 (PLCB2)
   04926 Relaxin signaling pathway
    104659669 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    104659669 (PLCB2)
   04918 Thyroid hormone synthesis
    104659669 (PLCB2)
   04919 Thyroid hormone signaling pathway
    104659669 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    104659669 (PLCB2)
   04916 Melanogenesis
    104659669 (PLCB2)
   04924 Renin secretion
    104659669 (PLCB2)
   04925 Aldosterone synthesis and secretion
    104659669 (PLCB2)
   04927 Cortisol synthesis and secretion
    104659669 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104659669 (PLCB2)
   04270 Vascular smooth muscle contraction
    104659669 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    104659669 (PLCB2)
   04971 Gastric acid secretion
    104659669 (PLCB2)
   04972 Pancreatic secretion
    104659669 (PLCB2)
   04973 Carbohydrate digestion and absorption
    104659669 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104659669 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    104659669 (PLCB2)
   04725 Cholinergic synapse
    104659669 (PLCB2)
   04728 Dopaminergic synapse
    104659669 (PLCB2)
   04726 Serotonergic synapse
    104659669 (PLCB2)
   04720 Long-term potentiation
    104659669 (PLCB2)
   04730 Long-term depression
    104659669 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    104659669 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    104659669 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    104659669 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104659669 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659669 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104659669 (PLCB2)
   05016 Huntington disease
    104659669 (PLCB2)
   05017 Spinocerebellar ataxia
    104659669 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    104659669 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104659669 (PLCB2)
   04934 Cushing syndrome
    104659669 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104659669 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104659669 (PLCB2)
   05142 Chagas disease
    104659669 (PLCB2)
   05143 African trypanosomiasis
    104659669 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104659669 (PLCB2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104659669 (PLCB2)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104659669 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104659669 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 Gp58
Other DBs
NCBI-GeneID: 104659669
NCBI-ProteinID: XP_030786494
LinkDB
Position
5
AA seq 1166 aa
MSLLNPVLLPPRVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDILALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLNHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRMIFGDMLLTEPLEKFPLKPGVPLPSPEDLKGKILIKNKKNQFSTPTSSSKDPGGE
AEGSSPRSAPAVWAGEEGTELEDDQVEEEEEEESGNLDEEEIKKMQSDEGTAGLEVTAYE
EMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKAAVQFVDYNKRQMSRIY
PKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEFMRRP
DKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKLSP
STNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCLHS
ESNMPLTMPALFVFLEMKDYVPGAWADLTVALANPIKFFNAHDKRSEKLKEAMGGLPEKP
FPLASPVASQVNGALAPRSNGSPEPRTASLEELRELKGVVKLQRRHEKELRELERRGVRR
WEELLQRGAAQLAELGPRGAGGGGAGKLGPGKGSRKKRSLPCEESAGAAPGEGPEGMDAR
VRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMELAREKQAAELKALKEMAEID
TKEMKKKLETKRLEQIQGMTKVTTDKMAQERLKREINNSHIQEVVQVIKQMTENLEKHQE
KLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACFRTCFPSETKDKPE
RDCECPSELCERDPVIAKADAQESRL
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtgctgctgccccccagggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacaattgcctctccagttatcctccgtgtg
gatcctaagggctactatttatattggacatatcaaagtaaggagatggagtttctggat
atcaccagcatccgggacactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagcttcctgctgaagacactcaca
gtggtgtctggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggtctgggctgaggacatactggccctagtcaagcatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccctaaaggcaagaacgatgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gtgcagaggggccagctgtcacctgagggcatggtctggtttctctgtgggccggagaac
agtgtgctggcccaggacaagctgctgctcaaccatgacatgacacagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctgtccggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaagagcccattatcacccacggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagcgcctttaagacctccccc
tatcctatcatcctgtcatttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggatgatcttcggggatatgctgctcacagagcccctggaaaagttc
ccactgaaaccaggtgtccccctgcccagccctgaggatctcaagggcaagatcctcatc
aagaacaagaagaaccagttttccacccccacctcctccagtaaggatcctggtggggag
gctgagggcagcagcccacgcagtgcccctgcagtgtgggctggcgaggaagggactgag
ctggaggacgaccaggtggaagaggaagaggaggaggagtcaggaaacctggacgaagaa
gagattaagaagatgcagtcggatgagggcacagcaggcctggaagtgacagcttatgag
gagatgtccagcctagtcaattacattcagcccaccaagttcatctcctttgagttctct
gctcaaaagaaccgaagttatgtcatctcgtccttcacagaactcaaggcatatgacctg
ctttccaaggccgcggtgcagtttgtggactacaacaagcgccagatgagccgcatttac
cccaagggaacccgcatggactcctccaactacatgccccagatgttctggaatgctgga
tgccagatggttgccctcaacttccagacgatggacttgcccatgcagcagaacatggca
gtgtttgagttcaatgggcagagcggctacctcctcaagcacgagttcatgcgccggccg
gacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtggccaccaccctt
tctatcacggtgatctctgggcagttcctgtcagaacgcagtgtgcgcacctatgtggaa
gtggagctgtttggccttcctggggaccccaagaggcgctatcgaactaagctgtcaccc
agtaccaattccattaatcctgtctggaaggaggagccctttgtctttgagaagatcttg
atgcctgagctggcctctctcagggtggctgtgatggaggaaggcaacaagtttcttgga
caccgcatcatccccatcaatgccctaaattctgggtaccaccacctgtgcctacacagt
gagagcaacatgcccctcaccatgcctgcgctcttcgtcttcctggagatgaaggactat
gtacctggtgcctgggcagatctcactgtggccctcgccaaccccatcaagttcttcaat
gcccatgacaagaggtctgagaagctcaaggaggccatgggagggctgcctgagaagccc
ttcccactggcgagtccagttgccagccaggtcaatggtgcgttggccccaaggagcaat
gggtcaccagagccacggaccgccagcctggaggagctccgggagctaaagggcgtcgtg
aagctgcagcggcggcacgagaaggagctgcgggagttggagcggcgcggagtgcggcgc
tgggaggagctgctgcagcggggcgcggcgcagctggccgagctcgggccgcggggcgcg
gggggtggcggggccggcaagctcggcccgggcaaaggctctcgcaagaagaggagcctg
ccttgcgaggagagcgccggagccgcgccgggcgagggccctgagggcatggacgcgcgc
gtgcgggagctgaaggacaggctggagctggagctgctgcggcagggcgaggagcagtac
gagtgcgttctgaagcgcaaggagcagcacgcggccgagcaaatctccaaaatgatggag
ctggccagagagaaacaggcggcagagctgaaggccctgaaggagatggcggagatcgac
accaaagagatgaagaaaaagctggagaccaagagactggagcagatccagggcatgacc
aaagtcaccacagataagatggcccaggagaggttgaagagagagattaacaactcccac
atccaggaagtggtgcaggtgatcaagcagatgacagagaacttggagaagcaccaggag
aagctggaagagaagcaggctgcttgcctggaacagatacgggagatggaaaagcagttc
cagaaggaggcgctggcagagtatgaggccaggatgaagggtctggaggcagaggtgaag
gagtcggtgagggcctgcttcaggacctgctttccctctgagaccaaggacaagcctgag
agggactgcgagtgcccctcagagctgtgtgagcgggacccagtcatagcaaaggcagat
gcccaggagagccgcctttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668296
Entry
104668296         CDS       T03989                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04062  Chemokine signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04621  NOD-like receptor signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Module
rro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104668296 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104668296 (PLCB1)
   04310 Wnt signaling pathway
    104668296 (PLCB1)
   04371 Apelin signaling pathway
    104668296 (PLCB1)
   04020 Calcium signaling pathway
    104668296 (PLCB1)
   04070 Phosphatidylinositol signaling system
    104668296 (PLCB1)
   04072 Phospholipase D signaling pathway
    104668296 (PLCB1)
   04071 Sphingolipid signaling pathway
    104668296 (PLCB1)
   04022 cGMP-PKG signaling pathway
    104668296 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104668296 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104668296 (PLCB1)
   04613 Neutrophil extracellular trap formation
    104668296 (PLCB1)
   04621 NOD-like receptor signaling pathway
    104668296 (PLCB1)
   04062 Chemokine signaling pathway
    104668296 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    104668296 (PLCB1)
   04922 Glucagon signaling pathway
    104668296 (PLCB1)
   04929 GnRH secretion
    104668296 (PLCB1)
   04912 GnRH signaling pathway
    104668296 (PLCB1)
   04915 Estrogen signaling pathway
    104668296 (PLCB1)
   04921 Oxytocin signaling pathway
    104668296 (PLCB1)
   04926 Relaxin signaling pathway
    104668296 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    104668296 (PLCB1)
   04918 Thyroid hormone synthesis
    104668296 (PLCB1)
   04919 Thyroid hormone signaling pathway
    104668296 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    104668296 (PLCB1)
   04916 Melanogenesis
    104668296 (PLCB1)
   04924 Renin secretion
    104668296 (PLCB1)
   04925 Aldosterone synthesis and secretion
    104668296 (PLCB1)
   04927 Cortisol synthesis and secretion
    104668296 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104668296 (PLCB1)
   04270 Vascular smooth muscle contraction
    104668296 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    104668296 (PLCB1)
   04971 Gastric acid secretion
    104668296 (PLCB1)
   04972 Pancreatic secretion
    104668296 (PLCB1)
   04973 Carbohydrate digestion and absorption
    104668296 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104668296 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    104668296 (PLCB1)
   04725 Cholinergic synapse
    104668296 (PLCB1)
   04728 Dopaminergic synapse
    104668296 (PLCB1)
   04726 Serotonergic synapse
    104668296 (PLCB1)
   04720 Long-term potentiation
    104668296 (PLCB1)
   04730 Long-term depression
    104668296 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    104668296 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    104668296 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    104668296 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104668296 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668296 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104668296 (PLCB1)
   05016 Huntington disease
    104668296 (PLCB1)
   05017 Spinocerebellar ataxia
    104668296 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    104668296 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104668296 (PLCB1)
   04934 Cushing syndrome
    104668296 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104668296 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104668296 (PLCB1)
   05142 Chagas disease
    104668296 (PLCB1)
   05143 African trypanosomiasis
    104668296 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104668296 (PLCB1)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104668296 (PLCB1)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104668296 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104668296 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like PH_14 DUF1154
Other DBs
NCBI-GeneID: 104668296
NCBI-ProteinID: XP_030771455
LinkDB
Position
13
AA seq 1115 aa
MITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKL
QVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCP
RPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
NSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLA
GNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFK
TSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYK
ILVKNKKKSHKSSEGSGKKKLSEQASNTCSDSSSMFEPSSPGAGEADTESDDDDDDDDCK
KSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTK
SPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYE
YNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDM
FGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRI
LPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLME
QRAKQLAALTLEDEEEVKKEADPGETPSETPSEVRTTPAENGVNHTTSLTPKPPSQALHS
QPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKT
TDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEM
TQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEIC
EKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQ
EKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGS
APLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgatcacggtggtatatggacctgacctcgtgaacatctcccatttgaatctcgtggct
ttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaacctg
ctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaagctg
caagtcactccagaggggcgtattcctctcaaaaacatatatcgcttgttttcagcagac
cggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgattca
atacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgccct
cgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatcttacc
gttgaccagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaaata
ctttatccaccgctaaaacaagagcaagtccaagtattgattgagaagtatgaacccaac
aacagcctcgccaaaaaaggacaaatatcagtggatgggttcatgcgctatctgagtgga
gaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcagccc
ctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactggct
ggaaactcctctgttgagatgtatcgccaagtgcttctgtctggttgtcgctgtgtggag
ctggactgctggaagggacgaactgcagaagaggaacctgtcatcacccatggcttcacc
atgacaactgaaatatctttcaaggaagtgatagaagcaatagcggagtgtgcatttaag
acttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcagcaa
gccaagatggcggagtactgccgactgatcttcggggatgcccttctcatggagcccctg
gaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtataaa
attttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaagaag
ctctcagaacaagcctccaacacctgcagtgactcctccagcatgttcgagccctcatcc
ccaggagccggagaagctgatacggaaagtgacgacgatgatgatgatgatgactgtaaa
aaatcttcaatggatgaggggaccgctggaagtgaggctatggccacagaagaaatgtct
aacctggtgaactacattcagccggtcaagtttgagtcatttgaaatttcaaaaaaaaga
aataaaagttttgaaatgtcttcctttgtggaaaccaaaggacttgaacaactcaccaag
tctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaagga
acacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcagatg
gtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtatgaa
tacaacggaaagagtggctatagattgaagccagagttcatgaggaggcctgacaagcat
tttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgttaag
attatttcaggtcagtttctttctgataagaaagtcgggacttatgtggaagtggatatg
tttggtttgcctgtggatacaaggaggaaggcatttaagaccaagacatcccaaggaaat
gctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcctact
ctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgtatc
ttgccagtgcaagccattcggccaggctatcactatatatgtctaaggaatgaaaggaac
cagcctctgacactgcctgctgtctttgtctacatagaagtgaaagactatgtgccagac
acatatgcagatgtcattgaagctttatcaaacccaatccggtatgtgaacctgatggag
cagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaagag
gctgatcctggagaaacaccatcagagactccaagtgaagtgagaacgactccagcagaa
aacggggtgaatcacactacatccctgacacccaagccaccctcccaggctctccacagc
caaccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagtgtc
ttaacagaagtggaagcacagaccatcgaagagctaaagcaacagaaatcgtttgtgaaa
cttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaaacc
actgacctgatcaaagaacacactaccaagtataatgaaattcagaatgactacttgaga
aggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaacccagc
agccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaaatg
acccaaaaattaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgacaa
gaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaaaag
ttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatctgt
gagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagataaca
gaagctaaatctaaagacaaaagtcagatggaagaggagaagacagagatgatccggtca
tatatccaggaagtggtgcagtacatcaagaggctagaagaggcgcaaagtaaacggcaa
gaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagcccaag
ctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgagatt
ttggaatttgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggttct
gcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagtgag
gagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673127
Entry
104673127         CDS       T03989                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04062  Chemokine signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04621  NOD-like receptor signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Module
rro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104673127 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104673127 (PLCB3)
   04310 Wnt signaling pathway
    104673127 (PLCB3)
   04371 Apelin signaling pathway
    104673127 (PLCB3)
   04020 Calcium signaling pathway
    104673127 (PLCB3)
   04070 Phosphatidylinositol signaling system
    104673127 (PLCB3)
   04072 Phospholipase D signaling pathway
    104673127 (PLCB3)
   04071 Sphingolipid signaling pathway
    104673127 (PLCB3)
   04022 cGMP-PKG signaling pathway
    104673127 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104673127 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104673127 (PLCB3)
   04613 Neutrophil extracellular trap formation
    104673127 (PLCB3)
   04621 NOD-like receptor signaling pathway
    104673127 (PLCB3)
   04062 Chemokine signaling pathway
    104673127 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    104673127 (PLCB3)
   04922 Glucagon signaling pathway
    104673127 (PLCB3)
   04929 GnRH secretion
    104673127 (PLCB3)
   04912 GnRH signaling pathway
    104673127 (PLCB3)
   04915 Estrogen signaling pathway
    104673127 (PLCB3)
   04921 Oxytocin signaling pathway
    104673127 (PLCB3)
   04926 Relaxin signaling pathway
    104673127 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    104673127 (PLCB3)
   04918 Thyroid hormone synthesis
    104673127 (PLCB3)
   04919 Thyroid hormone signaling pathway
    104673127 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    104673127 (PLCB3)
   04916 Melanogenesis
    104673127 (PLCB3)
   04924 Renin secretion
    104673127 (PLCB3)
   04925 Aldosterone synthesis and secretion
    104673127 (PLCB3)
   04927 Cortisol synthesis and secretion
    104673127 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104673127 (PLCB3)
   04270 Vascular smooth muscle contraction
    104673127 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    104673127 (PLCB3)
   04971 Gastric acid secretion
    104673127 (PLCB3)
   04972 Pancreatic secretion
    104673127 (PLCB3)
   04973 Carbohydrate digestion and absorption
    104673127 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104673127 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104673127 (PLCB3)
   04725 Cholinergic synapse
    104673127 (PLCB3)
   04728 Dopaminergic synapse
    104673127 (PLCB3)
   04726 Serotonergic synapse
    104673127 (PLCB3)
   04720 Long-term potentiation
    104673127 (PLCB3)
   04730 Long-term depression
    104673127 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    104673127 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    104673127 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    104673127 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104673127 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673127 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104673127 (PLCB3)
   05016 Huntington disease
    104673127 (PLCB3)
   05017 Spinocerebellar ataxia
    104673127 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    104673127 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104673127 (PLCB3)
   04934 Cushing syndrome
    104673127 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104673127 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104673127 (PLCB3)
   05142 Chagas disease
    104673127 (PLCB3)
   05143 African trypanosomiasis
    104673127 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104673127 (PLCB3)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104673127 (PLCB3)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104673127 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104673127 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 104673127
NCBI-ProteinID: XP_010375377
UniProt: A0A2K6PSK0
LinkDB
Position
15
AA seq 1234 aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPSGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQVLLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSTGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEGGLEKPSLEPRKSLGE
EGLNRGPYALGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQEMCQDTQSQQL
GSQLSPNPTPSPLDASPRRPPGPTTSPTSTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLQSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKTRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGLLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt   +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccagtggcttcttcttgtactggacaggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtccgaggagctgttcaagctggctatg
aacatcctggctcagaatgcctcccggaacaccttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaatttcaaccggagt
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacactggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgccgctgcggccctcccaggcccgactgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcaccgacatgacc
cagccgctgagtgcctacttcatcaactcctcgcataacacctatctcactgctgggcag
ctggccgggacctcgtcggtggagatgtaccgccaggtgctgctgtggggctgccgctgt
gtggagctggatgtgtggaaaggacggccgcccgaggaggaacccttcatcacccatggc
ttcaccatgaccacggaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctaccccgtcatcctctccttcgagaaccacgtggactcggcaaag
cagcaggcaaagatggctgagtactgccgctccatttttggagatgcgctactcatcgat
cctctggacaagtacccgctggccccaggtgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcacagacccagcacaggtggcccagacagc
gctgggcgcaagcggccgctggagcagagcaattcagccctgagcgagagctccgctgcc
actgagccctcctccccgcagcttgggtcgcccagctctgacagctgcccaggcctgagc
aacggggaggagggggggcttgagaagcccagcctagagcctcggaagtctctgggcgag
gagggcctgaaccggggcccctatgctcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggagcagacagaccccaaaaagccgaccacagatgagggcacggcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagtcccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgtgtggactcttccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagacccttgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctg
aagccggagttcatgcggcggcctgacaaatccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctatccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggatgaggagccc
tttgacttccccaaggtggtgctgcctacgctggcttcacttcgcatcgcagcctttgag
gaggggggtaaatttgtagggcaccggatcctgcctgtctctgccatccgctctggttac
cactacgtctgcctgcggaacgaggccaaccagccgctgtgccttccggccctgctcatc
tacactgaagcctcggactacattcctgatgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagatgtgccaggacacccagtctcagcagctg
gggtctcagctgtccccaaaccccacccctagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctaccagcacctccctcagcagcccagggcagcgtgacgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccagagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggcggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggagcat
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggaactgcagaagattctggacaga
aagcgccataacagcatctcggaggccaagacgagggataagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgcaggagcctgctgggcgagatgccggaggggctgggg
gatgggcttctggtggcctgtgccagcaacggtcacgcacctgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacacagctctga

DBGET integrated database retrieval system