KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655840
Entry
104655840         CDS       T03989                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04015  Rap1 signaling pathway
rro04062  Chemokine signaling pathway
rro04137  Mitophagy - animal
rro04144  Endocytosis
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04540  Gap junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04625  C-type lectin receptor signaling pathway
rro04727  GABAergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05219  Bladder cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104655840 (SRC)
   04015 Rap1 signaling pathway
    104655840 (SRC)
   04370 VEGF signaling pathway
    104655840 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104655840 (SRC)
   04137 Mitophagy - animal
    104655840 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104655840 (SRC)
   04520 Adherens junction
    104655840 (SRC)
   04530 Tight junction
    104655840 (SRC)
   04540 Gap junction
    104655840 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104655840 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104655840 (SRC)
   04613  Neutrophil extracellular trap formation
    104655840 (SRC)
   04625 C-type lectin receptor signaling pathway
    104655840 (SRC)
   04062 Chemokine signaling pathway
    104655840 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104655840 (SRC)
   04915 Estrogen signaling pathway
    104655840 (SRC)
   04917 Prolactin signaling pathway
    104655840 (SRC)
   04921 Oxytocin signaling pathway
    104655840 (SRC)
   04926 Relaxin signaling pathway
    104655840 (SRC)
   04919 Thyroid hormone signaling pathway
    104655840 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    104655840 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104655840 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    104655840 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104655840 (SRC)
   05203 Viral carcinogenesis
    104655840 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    104655840 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104655840 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104655840 (SRC)
   05152 Tuberculosis
    104655840 (SRC)
   05100 Bacterial invasion of epithelial cells
    104655840 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104655840 (SRC)
   05168 Herpes simplex virus 1 infection
    104655840 (SRC)
   05163 Human cytomegalovirus infection
    104655840 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104655840 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104655840 (SRC)
   01522 Endocrine resistance
    104655840 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104655840 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104655840 (SRC)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104655840 (SRC)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  SRC family
   104655840 (SRC)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    104655840 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    104655840 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    104655840 (SRC)
  Macropinocytosis
   Kinases
    104655840 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 104655840
NCBI-ProteinID: XP_010353661
LinkDB
Position
13
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENAHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgcccatggcgctggcgggggcgctttcccggcctcccagacccccagcaag
ccggcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggcggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctatccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacgggacagacaggctacatccccagcaactacgtg
gcaccctccgactccatccaggccgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaacgcggagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacaaaaggtgcctactgcctctcagtgtccgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcaactggtggcctactactccaaacatgccgatggcctc
tgccaccgcctcaccactgtgtgccccacatccaagcctcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggcactaccagagtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcggaggagcccatttacatcgtc
acagagtacatgagcaaggggagtttgctggactttctcaagggggagacgggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtatgtg
gagcggatgaactacgtccaccgggatcttcgtgcagccaacatcctggtaggagagaac
ctagtgtgcaaagtggccgacttcgggctggctcggctcatcgaagacaatgagtacacg
gcccggcaaggtgccaaatttcccatcaagtggacggctccggaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtcctttgggatcctgctgactgagctcaccaca
aagggacgagtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccaccggagtgtcctgagtccctgcatgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115895854
Entry
115895854         CDS       T03989                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04015  Rap1 signaling pathway
rro04062  Chemokine signaling pathway
rro04137  Mitophagy - animal
rro04144  Endocytosis
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04540  Gap junction
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04625  C-type lectin receptor signaling pathway
rro04727  GABAergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05219  Bladder cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    115895854
   04015 Rap1 signaling pathway
    115895854
   04370 VEGF signaling pathway
    115895854
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    115895854
   04137 Mitophagy - animal
    115895854
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    115895854
   04520 Adherens junction
    115895854
   04530 Tight junction
    115895854
   04540 Gap junction
    115895854
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    115895854
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    115895854
   04613  Neutrophil extracellular trap formation
    115895854
   04625 C-type lectin receptor signaling pathway
    115895854
   04062 Chemokine signaling pathway
    115895854
  09152 Endocrine system
   04912 GnRH signaling pathway
    115895854
   04915 Estrogen signaling pathway
    115895854
   04917 Prolactin signaling pathway
    115895854
   04921 Oxytocin signaling pathway
    115895854
   04926 Relaxin signaling pathway
    115895854
   04919 Thyroid hormone signaling pathway
    115895854
  09156 Nervous system
   04727 GABAergic synapse
    115895854
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    115895854
  09158 Development and regeneration
   04360 Axon guidance
    115895854
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    115895854
   05203 Viral carcinogenesis
    115895854
  09162 Cancer: specific types
   05219 Bladder cancer
    115895854
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    115895854
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    115895854
   05152 Tuberculosis
    115895854
   05100 Bacterial invasion of epithelial cells
    115895854
  09172 Infectious disease: viral
   05161 Hepatitis B
    115895854
   05168 Herpes simplex virus 1 infection
    115895854
   05163 Human cytomegalovirus infection
    115895854
   05167 Kaposi sarcoma-associated herpesvirus infection
    115895854
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    115895854
   01522 Endocrine resistance
    115895854
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    115895854
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    115895854
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     115895854
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  SRC family
   115895854
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    115895854
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    115895854
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    115895854
  Macropinocytosis
   Kinases
    115895854
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 115895854
NCBI-ProteinID: XP_030782296
LinkDB
Position
Unknown
AA seq 419 aa
REDWWLDHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLV
RESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHA
DGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAI
KTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGET
GKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDN
EYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQ
VERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1262 nt   +upstreamnt  +downstreamnt
agagggaggactggtggctggaccactcgctcagcacgggacagacaggctacatcccca
gcaactacgtggcaccctccgactccatccaggccgaggagtggtattttggcaagatca
ccagacgggagtcagagcggttactgctcaacgcggagaacccgagagggaccttcctcg
tgcgagaaagtgagaccacaaaaggtgcctactgcctctcagtgtccgacttcgacaacg
ccaagggcctcaacgtgaagcactacaagatccgcaagctggacagcggcggcttctaca
tcacctcccgcacccagttcaacagcctgcagcaactggtggcctactactccaaacatg
ccgatggcctctgccaccgcctcaccactgtgtgccccacatccaagcctcagactcagg
gcctggccaaggatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgg
gccagggctgctttggcgaggtgtggatggggacctggaacggcactaccagagtggcca
tcaaaaccctgaagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtca
tgaagaagctgaggcatgagaagctggtgcagttgtatgctgtggtttcggaggagccca
tttacatcgtcacagagtacatgagcaaggggagtttgctggactttctcaagggggaga
cgggcaagtacctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggca
tggcgtatgtggagcggatgaactacgtccaccgggatcttcgtgcagccaacatcctgg
taggagagaacctagtgtgcaaagtggccgacttcgggctggctcggctcatcgaagaca
atgagtacacggcccggcaaggtgccaaatttcccatcaagtggacggctccggaagctg
ccctctatggccgcttcaccatcaagtcggacgtgtggtcctttgggatcctgctgactg
agctcaccacaaagggacgagtgccctaccctgggatggtgaaccgcgaggtgctggacc
aggtggagcggggctaccggatgccctgcccaccggagtgtcctgagtccctgcatgacc
tcatgtgccagtgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcagg
ccttcctggaggactacttcacgtccaccgagccccagtaccagcccggggagaacctct
ag

DBGET integrated database retrieval system