KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655958
Entry
104655958         CDS       T03989                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2 isoform X1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04730  Long-term depression
rro04921  Oxytocin signaling pathway
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104655958 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104655958 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104655958 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104655958 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104655958 (GUCY1A2)
   04924 Renin secretion
    104655958 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104655958 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    104655958 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    104655958 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104655958 (GUCY1A2)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104655958 (GUCY1A2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Other DBs
NCBI-GeneID: 104655958
NCBI-ProteinID: XP_030774723
LinkDB
Position
15
AA seq 731 aa
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPPEPSAAAAAAAAAAP
APAASAAAAAATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQVI
GYRDAEKNFHNISNRCSYAEHSNKEEIEDVSGILQCTANILGLKFEEIQERFGEEFFNIC
FHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLMLHYFH
PHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECENTNI
TKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVLKFE
DCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSILF
LGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQ
ALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQ
VISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSE
EVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPT
TYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVSYN
IGTMFLRETSL
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtccgagtccttcagctccctgggctccgactacctggag
actagcccggaggaggagggggagtgccccctgtctaggctctgctggaatggcagccgg
agcccgcccgggccgccggagcccagcgcggccgccgctgccgctgccgccgccgcccca
gccccggctgcttctgccgccgccgccgccgccacggccggggccaggagggtgcagcgc
cggaggcgggtcaacctggactcgctgggcgagagcatcagccgcctgacggcgccctcg
cctcagacgatacagcaaactctcaagaggacactgcagtattatgaacatcaagttatt
ggttacagggatgcagaaaagaatttccacaatatctctaacagatgctcctatgcagaa
cactccaacaaagaagaaatcgaagatgtctcaggaattcttcagtgtactgctaatata
ctcggtttgaagtttgaggaaattcaagaaagatttggtgaagagttctttaatatatgc
tttcatgagaatgagagagtccttcgagctgtaggtggcactttgcaggacttttttaac
ggctttgatgctttgttggaacacattagaacttcttttggaaaacaggccactctggag
tcaccatctttcctatgcaaagagcttcctgaaggcactctcatgctccactacttccac
cctcaccatattgtggggtttgcaatgctggggatgattaaggctgcaggaaagaagatc
tatcggctggatgtggaagtggaacaggttgcaaatgagaagctatgctctgatgtttca
aacccaggcaattgtagctgtcttactttccttatcaaagaatgtgaaaatactaatatc
acgaagaaccttccacagggaacctcccaagttcctgcggacctcagaattagcatcaac
accttctgcagagccttccctttccacttgatgtttgaccccagcatgtcagtccttcag
ctgggggaaggtctaaggaagcagcttcgatgtgacactcacaaagtgctcaagtttgag
gactgcttcgagattgtatctccaaaggttaatgccacctttgaaagggtcctactgcga
ctgtctaccccgtttgtgattagaaccaagcctgaggcttctggctctgaaaataaagac
aaggtgatggaagtcaaaggacaaatgatccatgttccagaatcaaattccattttattt
ttgggctctccatgtgtggacaagttggatgaactcatgggccgagggctacatctctca
gacatccctatccatgatgccacccgagatgtcattttggttggtgagcaggcaaaggcc
caagatggcttgaagaaaaggatggataaattaaaggcaactttagaaagaactcaccag
gccctagaagaagagaaaaagaagacagtggatcttctatattctattttccctggcgat
gtagcccagcaattgtggcaagggcagcaagtacaggccagaaagtttgatgatgtcacc
atgctcttttcagacattgttggcttcacagccatatgtgcccagtgtactcccatgcaa
gtaatcagcatgctgaatgaactgtacaccagatttgaccaccagtgtggatttttggat
atttataaggtggaaacaataggtgatgcctactgtgttgcagcagggctccacagaaaa
agcctctgccatgctaaacccattgctctgatggccttgaagatgatggaactttcagaa
gaggtgctgacacctgatggaagaccgattcagatgaggataggaattcactcgggctct
gtgctggctggagttgttggggtgcgaatgccacgttactgcctgtttggaaataatgtc
acgctggcaagcaaattcgagtcgggaagtcaccctcggcgcatcaatgtcagcccaacc
acttaccaattattaaaacgggaagaaagtttcacattcattccacggtctcgtgaagag
cttccagacaactttccaaaggaaattcctgggatctgctatttcctggaggtaaggact
ggtccaaagccaccaaagccttctctttcttcgtcgagaataaaaaaggtttcctacaac
atcggcaccatgttcctccgggagacaagcctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658100
Entry
104658100         CDS       T03989                                 

Gene name
GUCY1A1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-1 isoform X1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04730  Long-term depression
rro04921  Oxytocin signaling pathway
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104658100 (GUCY1A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104658100 (GUCY1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104658100 (GUCY1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104658100 (GUCY1A1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104658100 (GUCY1A1)
   04924 Renin secretion
    104658100 (GUCY1A1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104658100 (GUCY1A1)
  09154 Digestive system
   04970 Salivary secretion
    104658100 (GUCY1A1)
  09156 Nervous system
   04730 Long-term depression
    104658100 (GUCY1A1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104658100 (GUCY1A1)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104658100 (GUCY1A1)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 104658100
NCBI-ProteinID: XP_010356333
UniProt: A0A2K6NIL8
LinkDB
Position
2
AA seq 690 aa
MFCTKLKDLKITGECPFSLLAPGQVPNESAEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNLALQRTLAKHKIKESRKSLEREDFEKIIAE
QAVAAGVPVEVIKESLGEELFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHVKSTRPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDSNANFLGKASGID
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgttctgcacgaagctcaaggatctcaagatcacaggagagtgtcctttctccctactg
gcaccaggtcaagttcctaatgagtctgcagaggaggcagcaggaagctcagagagctgc
aaagcaactgtgcccatctgtcaagacattcctgagaagaacatacaagaaagtcttcct
caaagaaaaacgagtcggagccgagtctatcttcacactttggcagagagtatttgcaaa
ctgattttcccagagtttgaacggctgaaccttgcacttcagagaacattggcaaagcac
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaataattgcagag
caagcagttgcagcaggagttccagtggaggttatcaaagaatctcttggtgaagagctt
tttaaaatatgttacgaggaagatgaaaacatccttggggtggttggaggcactctcaaa
gattttttaaacagcttcagtacccttctgaaacagagcagccattgccaagaagcagga
aaaaggggcagacttgaggacgcctccattctatgcctggataaggaggatgattttcta
catgtttactacttcttccctaagagaaccacctccctgattcttcctggcatcataaag
gcagctgctcacgtattatatgaaaccgaagtggaagtgtcgttaatgcctccctgcttc
cataatgattgcagcgagtttgtgaatcagccctatttgttgtactccgttcacgtgaaa
agcaccaggccatccctgtcccccagcaaaccccagtcctcgctggtgattcccacatcg
ctcttctgcaagacatttccattccatttcatgtttgacaaagatatgacaattctgcaa
tttggcaatggcatcagaaggctgatgaacaggagagactttcaaggaaagcctaatttt
gaagaatactttgaaattctgactccaaaaatcaaccagacgttcagcgggatcatgact
atgttgaatatgcagtttgttgtacgggtgaggagatgggacaactccgtgaagaaatct
tcaagggttatggacctcaaaggccaaatgatctacattgttgaatccagtgcaatcttg
tttttggggtcaccctgtgtggacagattagaagattttacaggacgaggactctacctt
tcagacatcccaattcacaatgcactgagggatgtggtcttgataggggagcaagcccga
gctcaagatggcctgaagaagaggctagggaagctgaaggccactcttgagcaagcccac
caagccctggaggaggagaagaaaaagacagtagaccttctgtgctccatatttccctgt
gaggttgctcagcagctgtggcaagggcaagttgtgcaagccaagaagttcagtaatgtc
accatgctcttttcagacatcgttgggttcactgccatctgctcccagtgctcaccgctg
caggtcatcaccatgctcaacgcactctacactcgctttgaccagcagtgtggagagctg
gatgtctacaaggtggagaccattggcgatgcctattgtgtagctgggggattacacaaa
gagagtgatactcatgctgttcagatagcgctgatggccctgaagatgatggagctctct
gatgaagttatgtctccccatggagaacctatcaagatgcgaattggactgcattctgga
tcagtttttgctggcgttgttggagtcaaaatgccccgttactgtctttttggaaacaat
gtcactctggctaacaaatttgagtcctgcagtgtaccacgaaaaatcaatgtcagccca
acaacttacagattactcaaagactgtcctggtttcgtgtttacccctcgatcaagggaa
gaacttccacctaacttccctagtgaaatccctggaatctgccattttctggatgcttac
caacaaggaacaaactcaaaaccatgcttccaaaagaaagatgtggaagatagcaatgcc
aattttttaggcaaagcatcaggaatagattag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658102
Entry
104658102         CDS       T03989                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1 isoform X1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04730  Long-term depression
rro04921  Oxytocin signaling pathway
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104658102 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104658102 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104658102 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104658102 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104658102 (GUCY1B1)
   04924 Renin secretion
    104658102 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104658102 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    104658102 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    104658102 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104658102 (GUCY1B1)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104658102 (GUCY1B1)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 104658102
NCBI-ProteinID: XP_010356336
UniProt: A0A2K6QJ78
LinkDB
Position
2
AA seq 619 aa
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagctgctggtgatccgcaattacggccccgag
gtgtgggaagatatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgtgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctactatctacccaggaatgcgtgcaccttccttt
aggtgcactgatgcagaaaagggcaaaggactcattctgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggctcaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctctctgtcttctcgctggttcgtcctcat
attgatattagtttccatgggatcctttcgcacatcaatacggtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagagtgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctgtgttcaccaagtgtcatgaacctggacgatttgacaaggagagggctgtatcta
agtgacatccctctgcatgatgccacgcgcgatctcgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacgtta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctcca
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatccttttcagtggtattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggggccatgaagatcgtaaaccttctcaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggttcaagtagatggggaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttggaaatactgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccatttggagcaccgaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgacgactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662724
Entry
104662724         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04730  Long-term depression
rro04921  Oxytocin signaling pathway
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104662724
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104662724
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104662724
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104662724
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104662724
   04924 Renin secretion
    104662724
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104662724
  09154 Digestive system
   04970 Salivary secretion
    104662724
  09156 Nervous system
   04730 Long-term depression
    104662724
  09159 Environmental adaptation
   04713 Circadian entrainment
    104662724
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104662724
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 104662724
NCBI-ProteinID: XP_030778082
LinkDB
Position
18
AA seq 615 aa
MSGCDRMLRTLGGNLMEFIENLDALHSYLALSYQEMHAPSFRVERGADGKMFLHYYSDRS
GLCHIVPGIIEAVAKDFFDIEVTMDIFDMNEEVERTGKKEHVVFLKAHRKMRKAKSERLQ
DSQCIERDQEALQAAFLRMKEKYLNVSACPVKKSHWDVVRSMVMFGKGHLMNAFEPIYPE
RLWIEEKTFCNAFPFHIVFDESLQVKQAGVNIQKYMPGLQTQKIQLDEYFSIIHPQVTFN
IFSIPKFINSQFVLKTXREMMPVAWXSQTTLKFRGQMIWMESMQCMVYLCSLKLRSLHEL
EXLNMHLSDIXPDDTTKDLILLNQQRLAKIELSNQLEMKKKEGLRVLSKHLATEKKKTET
LLYAMLPKHVANQLREGKKVSAGEFKNCTILFSDVVTFTDICAACEPIQIVNMLNSMYSK
FDRLTSVHAVYKVETIGDAYMVVGGVPVPTGSHAQRVANFALGMRISAKEVMNPVTGEPI
QIRMGIYTGPVLAGVVGDKMPQYCLFGDTVNIASGMESHGLPNKVHLSPTAYSALKNQGF
EIIERGEIKVKGKGKMTTHFLIQNLNATEDEIMQRSKTPLDHKGSTQMVSLPTTKFQGSV
QPSCPEHSSLVSWLL
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtctggctgtgacaggatgctacggacactgggaggaaatctcatggagtttattgaa
aacctggatgccctccacagttacctggcactctcttatcaggagatgcatgcaccgtcg
tttcgtgtggagagaggagcagatgggaaaatgtttctccattactactcagatagaagt
ggtctctgccatattgtaccaggtatcattgaggctgtggccaaagacttctttgacatt
gaggtaaccatggacatttttgacatgaatgaagaagtggagaggacagggaagaaggag
catgttgtgtttctgaaggctcacaggaagatgagaaaggcaaagtcagaaaggctacaa
gacagtcagtgcatcgagagagaccaagaggccctccaggcagctttcctcaggatgaag
gagaaatatttgaatgtttctgcttgtcctgtgaaaaaatcccactgggatgttgtgaga
agcatggtcatgtttggaaaagggcatctcatgaacgcctttgagccaatttatcctgag
agactctggattgaagagaagacattctgcaacgcttttcctttccacattgtatttgat
gaatcactacaggtgaagcaagctggagtgaacattcagaagtacatgccaggactccaa
acccagaagattcaactggatgagtatttctccatcattcatcctcaagttaccttcaac
attttcagcatccccaaatttatcaacagtcaatttgtcctgaagacatgaagagaaatg
atgcctgtagcatggtaaagtcagaccacactcaaatttcgaggccagatgatctggatg
gagtccatgcagtgcatggtgtacctgtgctctctgaagctccgcagcctgcacgagctg
gaangactcaatatgcatctttctgacatcngacccgatgacaccaccaaggatctcatc
ctcctgaaccagcagcggctggctaagatagagttgtccaaccagctggaaatgaagaag
aaggaagggctacgggtcctctccaagcacttggccactgaaaagaaaaaaacagagacc
ttgctttatgccatgctgcccaaacatgtggccaaccagctgagggagggcaaaaaggtg
tctgcaggagaatttaaaaactgcacgattcttttcagcgatgtggtgacatttactgac
atctgtgctgcctgtgaacctatacaaatagtgaacatgctgaactccatgtactccaag
tttgacagattaaccagtgtgcacgcagtctataaagtagaaacaataggagatgcatat
atggtggtaggaggtgtaccagtgcctactggaagccatgctcaaagagtggctaatttt
gccttggggatgagaatttctgcaaaggaagtgatgaatcctgttactggagaacccatc
cagatcagaatggggatctacactggaccagtcttagcaggtgttgtaggagacaagatg
ccacagtactgcttatttggtgacactgtgaacatagcttctgggatggaaagtcatggg
cttcccaacaaagtgcacctcagccccacagcctacagtgccttaaaaaatcaagggttt
gaaatcattgagaggggtgaaatcaaagtgaaaggtaaagggaaaatgaccacacacttt
ttgatccagaacttgaatgccacagaggacgagatcatgcagagatctaaaaccccactt
gatcacaaggggtcaacacagatggtgtccctgcccaccaccaagttccaaggctcagtt
caaccatcttgccctgaacactcttctcttgtatcctggttattatga

DBGET integrated database retrieval system