KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655987
Entry
104655987         CDS       T03989                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04360  Axon guidance
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04713  Circadian entrainment
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05030  Cocaine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05133  Pertussis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104655987 (GNAI3)
   04371 Apelin signaling pathway
    104655987 (GNAI3)
   04071 Sphingolipid signaling pathway
    104655987 (GNAI3)
   04024 cAMP signaling pathway
    104655987 (GNAI3)
   04022 cGMP-PKG signaling pathway
    104655987 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104655987 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104655987 (GNAI3)
   04670 Leukocyte transendothelial migration
    104655987 (GNAI3)
   04062 Chemokine signaling pathway
    104655987 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104655987 (GNAI3)
   04915 Estrogen signaling pathway
    104655987 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    104655987 (GNAI3)
   04921 Oxytocin signaling pathway
    104655987 (GNAI3)
   04926 Relaxin signaling pathway
    104655987 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    104655987 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    104655987 (GNAI3)
   04916 Melanogenesis
    104655987 (GNAI3)
   04924 Renin secretion
    104655987 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104655987 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    104655987 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104655987 (GNAI3)
   04727 GABAergic synapse
    104655987 (GNAI3)
   04725 Cholinergic synapse
    104655987 (GNAI3)
   04728 Dopaminergic synapse
    104655987 (GNAI3)
   04726 Serotonergic synapse
    104655987 (GNAI3)
   04730 Long-term depression
    104655987 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    104655987 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    104655987 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104655987 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655987 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104655987 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    104655987 (GNAI3)
   05032 Morphine addiction
    104655987 (GNAI3)
   05034 Alcoholism
    104655987 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104655987 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104655987 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104655987 (GNAI3)
   05163 Human cytomegalovirus infection
    104655987 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104655987 (GNAI3)
   05142 Chagas disease
    104655987 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104655987 (GNAI3)
   04031 GTP-binding proteins [BR:rro04031]
    104655987 (GNAI3)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104655987 (GNAI3)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    104655987 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 104655987
NCBI-ProteinID: XP_010353870
UniProt: A0A2K6PMI8
LinkDB
Position
8
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatcgac
cgcaacttacgggaggacggggaaaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggg
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccgacaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattatctaaatgatctggat
agaatatcccagtctaactacattccaactcagcaagatgttcttcggacacgagtgaag
accacaggcattgtagaaacgcatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attattttctgtgtggccctcagtgattatgaccttgttctggctgaggacgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gaaacttcaatcattctcttccttaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagagtacacaggttccaatacatatgaagaggcagct
gcctatattcaatgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacacgaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667102
Entry
104667102         CDS       T03989                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04360  Axon guidance
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04713  Circadian entrainment
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05030  Cocaine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05133  Pertussis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104667102 (GNAI2)
   04371 Apelin signaling pathway
    104667102 (GNAI2)
   04071 Sphingolipid signaling pathway
    104667102 (GNAI2)
   04024 cAMP signaling pathway
    104667102 (GNAI2)
   04022 cGMP-PKG signaling pathway
    104667102 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104667102 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104667102 (GNAI2)
   04670 Leukocyte transendothelial migration
    104667102 (GNAI2)
   04062 Chemokine signaling pathway
    104667102 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104667102 (GNAI2)
   04915 Estrogen signaling pathway
    104667102 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    104667102 (GNAI2)
   04921 Oxytocin signaling pathway
    104667102 (GNAI2)
   04926 Relaxin signaling pathway
    104667102 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    104667102 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    104667102 (GNAI2)
   04916 Melanogenesis
    104667102 (GNAI2)
   04924 Renin secretion
    104667102 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104667102 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    104667102 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    104667102 (GNAI2)
   04727 GABAergic synapse
    104667102 (GNAI2)
   04725 Cholinergic synapse
    104667102 (GNAI2)
   04728 Dopaminergic synapse
    104667102 (GNAI2)
   04726 Serotonergic synapse
    104667102 (GNAI2)
   04730 Long-term depression
    104667102 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    104667102 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    104667102 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104667102 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667102 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104667102 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    104667102 (GNAI2)
   05032 Morphine addiction
    104667102 (GNAI2)
   05034 Alcoholism
    104667102 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104667102 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104667102 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104667102 (GNAI2)
   05163 Human cytomegalovirus infection
    104667102 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104667102 (GNAI2)
   05142 Chagas disease
    104667102 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104667102 (GNAI2)
   04031 GTP-binding proteins [BR:rro04031]
    104667102 (GNAI2)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104667102 (GNAI2)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    104667102 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 104667102
NCBI-ProteinID: XP_010367612
UniProt: A0A2K6P024
LinkDB
Position
1
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggggagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggt
tactccgaggaggaatgccggcagtaccgggcggttgtttacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgacccctccaga
gcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaaggcgtgctc
cccgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcaagggaataccagctcaacgactcagccgcctactacctgaatgacctg
gagcgcattgcacagagtgactacatccccacgcagcaagatgtgttacggacccgcgta
aagaccacggggatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagccttgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctatttgacagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgttcgaagagaagatcaca
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaagtatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673307
Entry
104673307         CDS       T03989                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04360  Axon guidance
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04713  Circadian entrainment
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05030  Cocaine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05133  Pertussis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104673307 (GNAI1)
   04371 Apelin signaling pathway
    104673307 (GNAI1)
   04071 Sphingolipid signaling pathway
    104673307 (GNAI1)
   04024 cAMP signaling pathway
    104673307 (GNAI1)
   04022 cGMP-PKG signaling pathway
    104673307 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104673307 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104673307 (GNAI1)
   04670 Leukocyte transendothelial migration
    104673307 (GNAI1)
   04062 Chemokine signaling pathway
    104673307 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104673307 (GNAI1)
   04915 Estrogen signaling pathway
    104673307 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    104673307 (GNAI1)
   04921 Oxytocin signaling pathway
    104673307 (GNAI1)
   04926 Relaxin signaling pathway
    104673307 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    104673307 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    104673307 (GNAI1)
   04916 Melanogenesis
    104673307 (GNAI1)
   04924 Renin secretion
    104673307 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104673307 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    104673307 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    104673307 (GNAI1)
   04727 GABAergic synapse
    104673307 (GNAI1)
   04725 Cholinergic synapse
    104673307 (GNAI1)
   04728 Dopaminergic synapse
    104673307 (GNAI1)
   04726 Serotonergic synapse
    104673307 (GNAI1)
   04730 Long-term depression
    104673307 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    104673307 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    104673307 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104673307 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673307 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104673307 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    104673307 (GNAI1)
   05032 Morphine addiction
    104673307 (GNAI1)
   05034 Alcoholism
    104673307 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104673307 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104673307 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104673307 (GNAI1)
   05163 Human cytomegalovirus infection
    104673307 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104673307 (GNAI1)
   05142 Chagas disease
    104673307 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104673307 (GNAI1)
   04031 GTP-binding proteins [BR:rro04031]
    104673307 (GNAI1)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104673307 (GNAI1)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    104673307 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 104673307
NCBI-ProteinID: XP_030789039
LinkDB
Position
6
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgcgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgcttggt
gctggtgaatctggtaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt
tattcagaagaggagtgtaaacagtacaaagcagtcgtctacagtaacaccatccagtcg
attattgctatcattagggccatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcacgccaactctttgtgctagctggagctgccgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcgtactatttgaatgacttggac
agaatagctcagccaaattacatcccgactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagagatctgagcggaagaagtggattcattgcttcgaaggagtgacggcg
atcatcttctgtgtagcactgagtgactacgacctggttctagctgaagatgaagaaatg
aatcgaatgcatgaaagcatgaagttgtttgacagcatatgtaacaacaagtggtttaca
gatacatccattatactttttctgaacaagaaggatctctttgaagaaaaaatcaagaag
agccctctcactatatgctatccagaatatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttctaa

DBGET integrated database retrieval system