KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656113
Entry
104656113         CDS       T03989                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1 isoform X1
  KO
K05140  interferon lambda receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104656113 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104656113 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104656113 (IFNLR1)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104656113 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac DUF2052
Other DBs
NCBI-GeneID: 104656113
NCBI-ProteinID: XP_010354038
LinkDB
Position
12
AA seq 532 aa
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSRNFSVYLTWLPGLGNPQDVTYFVAYQ
SSPTPRRWRKVEECAGTKELLCSMMCLKKQDLYNKFKGRVQTVSPSSKSPWVESKYVDYL
FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEEAGNKTLFPVTPHGQ
PVRITLQPAASERHCLSARTIYTFSVPKYSEFSKPTCFLLEVPEANWAFLVLPSLLILLL
VIAAGGVIWKSLMGNPWFQRAKMPPALDFSGHTYPVATFQPSRPESLNDLLLCPQKELTR
GVRLTPRVRAPATQQTGWKKDLAEDEDEEEEEDTEDGISFQPYIEPPSFLGQEHQVPGHS
EVGGVDAGRPRAPLLPGEGSSAWDSSDKSWASTVDSSWDRAGSSGYLAEKGPGRGPGGDG
HQEPLPPPEFSTDSGFLEELPKDDLSSWATWGTLPPESNLVPGGPPVSLHTLTFCWESSL
EEEEEEEEEEEEEEEEEARESETEDSDAGSWGAESTQRTEERGRTLGYYMAR
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggcggggcccgagcgctggggccccctgctcctgtgcctactgcaggccgctccaggg
aggccccgtctggcccctccccagaatgtgacgctgctctcccggaacttcagcgtgtac
ctgacgtggctcccagggcttggcaacccccaggatgtgacctattttgtggcctatcag
agctctcccacccccagacggtggcgcaaagtggaagagtgtgcaggaaccaaggagctg
ctgtgttctatgatgtgcctgaagaaacaggacctgtacaacaagttcaaggggcgcgtg
cagacggtttctcccagctccaagtccccctgggtggagtccaaatacgtggattacctt
tttgaagtggagccggccccacctgtcctggtgctcacccagacggaggagatcctaagt
gccaatgccacgtaccagctgcccccctgcatgcccccactggatctgaagtatgaggtg
gcattctggaaggaggaggccggaaacaagaccctatttccagtcactccccatggccag
ccagtccggatcaccctccagccagctgccagcgaacgccactgcctcagtgccagaact
atctacaccttcagtgtcccgaaatacagcgagttctctaagcccacgtgcttcttgctg
gaggttccagaagccaactgggctttcctggtgctgccatcgcttctgatactgctgtta
gtaattgctgcagggggtgtgatctggaagagcctcatggggaacccctggtttcagcgg
gcaaagatgccaccggccctggacttttctggacacacatatcctgtggcaacctttcag
cccagcagaccagagtccctgaacgacttgctcctctgtccccaaaaggaactgaccaga
ggggtcaggctgacgcctagagtcagggccccagccacccaacagacaggatggaagaag
gaccttgcagaggacgaggacgaggaggaagaggaggacacagaagatggcatcagcttc
cagccctacattgagccaccttctttcctggggcaagagcaccaggttccagggcactcg
gaggttggtggggtggacgcagggaggcccagggctcctctgctcccgggcgaaggctcc
tctgcttgggattcttcagacaaaagctgggccagcactgtggactcctcctgggacagg
gctggatcctctggctatttggctgagaaggggccaggccgagggccgggtggggacggg
caccaagaacctctcccaccacctgaattctccacggactcgggtttcctggaagagctc
ccaaaagatgacctctcctcctgggccacctggggcaccttaccaccagagtcaaatctg
gtccctgggggtcccccagtttctcttcatacactgaccttctgctgggaaagcagcctt
gaggaggaagaggaggaagaagaggaagaggaggaagaagaggaagaggaggcgagggaa
tcagaaactgaggacagcgatgcgggcagctggggggctgagagtacccagaggaccgag
gagaggggccggacactggggtattacatggccaggtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656114
Entry
104656114         CDS       T03989                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1 isoform X1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104656114 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104656114 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104656114 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104656114 (IL22RA1)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104656114 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 104656114
NCBI-ProteinID: XP_010354040
UniProt: A0A2K6P9Z8
LinkDB
Position
12
AA seq 571 aa
MLWAGVIKKDHIAEEENCLAHAPEDPSDLLQHVKFQSNNFENILTWDSGPKGTPDTVYSI
EYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSTGGRSATKMTDRFSS
LQHTTLKPPDVTCIPKVRSIQMIVHPTPTPIHAGDGHRLTLEDIFHDLFYHLELQVNHTY
QMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWSKESAPYMCRVRTLPDRTWTYSFSGAF
LFSMGFLVAVLCYLSYRYVTKPPAPPNSLNIQRVLTFQPLRFIQEHVLIPVFDLSGPSSL
AQPVQYSQIRVSGPREPAGPPQRHSLSEITYLGQPDISILQPANVPPTQILSPLSYAPNA
APEVGPPSYAPQVTPEAQLPFYTPQAISKVQPPSYAPQATPDSWPPSYGVCVEGSGKDSP
TVTLSSPKHLRPKGQLQKEPPAGSCMSGGLSMEESQEAKSLHQPLGVCTDRTSDLNVLDC
GGEGTPQYLKSQLPLLSSVQIEGHPMSLPLHPPSRPCSPSDQSPSPWGLLESLVCPKDEA
KSLAPETSDLEPPTELDSLFRGLALTVQWES
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgttatgggctggagttatcaagaaggaccatattgcagaagaagagaactgtcttgct
cacgcccctgaggacccctcagatctgctccagcacgtgaaattccagtccaacaacttt
gaaaacatcctgacgtgggacagcgggccgaagggcaccccagacacggtctacagcatc
gagtataagacgtacggagagagggactgggtggcaaagaagggctgtcagcggatcacc
cgaaagtcctgcaacctgacggtggagacgggcaacctcacggagctctactatgccagg
gtcaccgctgtcagcacgggaggccggtcagccaccaagatgactgacaggttcagctct
ctgcagcacactaccctcaagccacctgatgtgacctgtatccccaaagtgagatcgatt
cagatgattgttcatcctacccccacgcccatccatgcaggggacggccaccggctaacc
ctggaagacatcttccatgacctattctaccacttagagctccaggtcaaccacacctac
caaatgcaccttggagggaagcaaagagaatatgagttcttcggactgacccctgacaca
gagttccttggcaccatcatgatttgtgttcccacctggtccaaggagagtgccccctac
atgtgccgagtgaggacactgccagaccggacgtggacctactccttctccggagccttc
ctgttctccatgggcttcctcgtcgcagtgctctgctacctgagctacagatatgtcacc
aagccgcctgcacctcccaactccctgaacatccagcgagtcctgactttccagccgctg
cgcttcatccaggagcatgtcctgatccctgtctttgacctcagcggccccagcagtctg
gcccagcctgtccagtactcccagatcagggtgtccggacccagggagcccgcaggacct
ccacagcggcacagcctgtccgagatcacctacttagggcagccggacatctccatcctc
cagcccgccaacgtgccacctacccagatcctctccccactgtcctatgccccaaatgct
gcccctgaggtcgggcccccatcctatgcacctcaggtgacccccgaagctcaactccca
ttctacaccccacaggccatctctaaggtccagcctccctcctatgcccctcaggcaact
ccagacagctggcctccctcctatggggtatgcgtggaaggttctggcaaagactccccc
actgtgacactttctagtcctaaacaccttaggcctaaaggtcagcttcagaaagagcca
ccggctggaagctgcatgtcaggtggcctttctatggaggaatcccaagaagcaaaatca
ttgcaccagcctctgggagtttgcacagacagaacatctgacctgaatgtgctagactgt
gggggggaggggacaccacagtacctaaagagccagctccccctcctctcctcagtccag
atcgagggccaccccatgtccctgcctttgcatcccccttcccgcccgtgctccccttcg
gaccagagtccaagtccctggggcctgctggagtctcttgtgtgtcccaaggatgaagcc
aagagcctagcccctgagacctcagacctggagccgcccacagagctggattctcttttc
agaggcctggccctgaccgtacagtgggagtcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656782
Entry
104656782         CDS       T03989                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
rro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104656782 (IL2RG)
   04151 PI3K-Akt signaling pathway
    104656782 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104656782 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104656782 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104656782 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104656782 (IL2RG)
   04659 Th17 cell differentiation
    104656782 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656782 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104656782 (IL2RG)
   05340 Primary immunodeficiency
    104656782 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104656782 (IL2RG)
   05162 Measles
    104656782 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104656782 (IL2RG)
   04090 CD molecules [BR:rro04090]
    104656782 (IL2RG)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104656782 (IL2RG)
CD molecules [BR:rro04090]
 Proteins
  104656782 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N
Other DBs
NCBI-GeneID: 104656782
NCBI-ProteinID: XP_010354774
UniProt: A0A2K6QBD0
LinkDB
Position
7
AA seq 369 aa
MLKPSLPFRSLLVLQLPLLGVALNTTILTSSGNEDATTDFFLTSVPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCGHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGPSPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcagatccctcttagtcctgcagctgcccctgctggga
gtggcgctgaacacaacaattctgacatccagtgggaatgaagacgccacaactgatttc
ttcctgacctctgtgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgttgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaattcggataatgataaagtccag
aagtgcggccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcgcaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccctgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccggtttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctccgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gccctcggggaggggcctgggccctccccatgtaaccagcatagcccctactgggccccc
ccatgttacaccctgaagcctgaaacctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657075
Entry
104657075         CDS       T03989                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2 isoform X1
  KO
K05077  interleukin 13 receptor alpha-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104657075 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104657075 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104657075 (IL13RA2)
   04090 CD molecules [BR:rro04090]
    104657075 (IL13RA2)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104657075 (IL13RA2)
CD molecules [BR:rro04090]
 Proteins
  104657075 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 104657075
NCBI-ProteinID: XP_030790002
LinkDB
Position
7
AA seq 400 aa
MGDNIKVLNLGEMAFVYLAVRCLYTFLISTTFGYTSSSDTEIKVNPPQDFEIVDPGYLGY
LYLQWQPPLSLDNFKECTVEYELKYRNIGSETWTTIITKNLHYKDGFDLNKGIEAKIHTL
LPWQCTNGSEVQSSWAEATYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTN
YNLFYWYEGLDHALQCVDYIKVDGQNIGCRFPYLESSDYKDFYICVNGSSDTKPIRSSYF
TFQLQNIVKPLPPVCLTCTQESLYEIKLKWSIPLGPIPARCFVYEIEIREDDTTLVTTTV
ENETYTLKITNETRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEVEELLKKTLLLFLLPF
GFILILVIFVTGLLLCKRDSYPKMNFSVIDEDFPYQETWY
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgggagacaatatcaaggttttaaatcttggagaaatggctttcgtttacttggctgtc
agatgcttatatacctttctcataagcacaacatttggctatacttcatcttcagacacc
gagataaaagttaaccctcctcaggattttgagatagtggatcccggatatttaggttat
ctctatttgcaatggcaacccccactgtctctggataattttaaggaatgcacagtggaa
tatgaactaaaataccgaaacattggtagtgaaacatggacgaccatcattactaagaat
ctacattacaaagatgggtttgatcttaacaagggcattgaagcaaagatacacacgctt
ttaccatggcaatgcacaaatggatcagaagttcaaagttcctgggcagaagctacttat
tggatatcgccacaaggaattccagaaactaaagttcaggatatggattgtgtgtattac
aactggcaatatttactctgttcttggaaacctggcataggtgtacttcttgataccaat
tacaacttgttttactggtatgagggcttggatcatgcattacagtgcgttgattacatc
aaggttgatggacaaaatattggatgcagatttccctatttggagtcatcagactataaa
gatttctatatttgtgttaatggatcatcagacaccaagcctatcagatccagttatttc
acttttcagcttcaaaatatagttaaacctttgccgccagtctgtcttacttgtactcag
gagagtttatatgaaattaagctgaaatggagcatacctttgggacctattccagcaagg
tgttttgtttatgaaattgagatcagagaagatgatacaaccttggtgactactacagtt
gaaaatgaaacgtacaccttgaaaataacaaatgaaacccgacaattatgctttgtagta
agaagcaaagtgaatatttattgctcagatgatggaatttggagtgagtggagtgataaa
caatgttgggaagttgaagaactattgaagaaaactttgctacttttcttgttaccattt
ggtttcatcttaatattagtcatatttgtaaccggtctacttttgtgtaagcgagacagc
tacccgaaaatgaatttttctgtgatagatgaagactttccatatcaagagacatggtat
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657309
Entry
104657309         CDS       T03989                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104657309 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104657309 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104657309 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657309 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104657309 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104657309 (IL12RB2)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104657309 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 104657309
NCBI-ProteinID: XP_010355377
UniProt: A0A2K6QN80
LinkDB
Position
12
AA seq 884 aa
MEKSEPGKNEEDKVLYQSRLLMAHTFRQCSLALIFIIMWLLIKAKIDECKRGDVTVKPSR
VILLGSTVNISCSLKPRQGCLPYSSRNKLILYKFDRKINFHHGHSLNAQVTGLPLGTTLF
VCKLACIKSDEIQICGAEILVGVAPEQPQNLSCIQKGEQGTVACTWERGQDTHLYTEYTL
QLSGPKNLTWQKQCKDHYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSFPSTFTFL
DIVRPLPPWDIRIKFQKTSSVSRCTLYWRDEGLVLLNRLRYRPSNSRHWNMVNVTEAKGR
HDLLDLKPFTEYEFQISSKLHLYKGSWSDWSETLRAQTPEEEPTGMLDVWYMKRHIDYSR
QRISLFWKNLSVSEARGKILHYQVTLQELTGGKVMTQNITGHTSWTTVISRTGNWAVAVS
AANSKGSSLPTRINIMNLCEAGLLAPRQVSANSESMGNILVTWQPPRKDLSAVQEYVVEW
RQLHPGDDTQIPLNWLRSPPYNVSALISENIKPYTCYEIRVYALSEDQGGCSSILGNSKH
KAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRV
SQNSHPINSLQPRVTYVLWMTALTAAGESSQGNEREFCLQGKANWMAFVAPSICIAIIMV
GIFSMHYFQQKLFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPM
PEDPEPLIISEVLHQVTPVVRRPHCSNWPQRGKGTQGHQASEKDMMHSASSPPLPRALPA
ESRQLVDLYKVLESRGSYPKPENPASPWTVLPAGNLPTHDGYLPSNIDDLPSHEVPLTDS
LEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML
NT seq 2655 nt   +upstreamnt  +downstreamnt
atggaaaagagtgaaccaggcaaaaatgaagaagacaaagttctataccagagtcgattg
ttgatggcacatacttttagacaatgctcactggcacttatttttataatcatgtggctg
ttgattaaagcaaaaatagatgagtgcaagagaggcgatgtgactgtgaagccttcccgt
gtaattttacttggatccactgtcaatatttcatgttctttgaagcccagacaaggctgc
ttgccctattccagtcgtaacaagttaatcctgtacaagtttgacagaaaaatcaatttt
caccatggccactccctcaatgctcaagtcacaggtcttcccctcggtacaaccttgttt
gtctgcaaactggcctgtatcaagagtgatgaaattcaaatatgtggagcagagatctta
gttggtgttgctccagaacagcctcaaaatttatcctgcatacagaagggagaacaaggg
actgtggcctgcacctgggaaagaggacaagacacccacctatacactgagtatactcta
cagttaagtggaccaaaaaatttaacctggcagaagcaatgtaaagatcattattgtgac
tatttggactttggaatcaacctcacccctgagtcacctgaatccaatttcacagccaag
gttaccgctgtcaatagtcttggaagctcctcttcatttccatccacattcacattcttg
gacatagtgaggcctcttcctccgtgggacattagaatcaaatttcaaaagacttcctcc
gtgagcagatgtaccctttattggagagatgagggactggtactgcttaatcgactcaga
tatcggcccagtaacagcaggcactggaatatggttaatgttacagaggccaaaggaaga
catgatttgctggatctaaaaccatttacagaatatgaatttcagatttcctctaagcta
catctttataagggaagttggagtgattggagtgaaacattgagagcacaaacaccagaa
gaagagcctactgggatgttagatgtctggtacatgaaacgacacattgactacagtaga
caacggatttctcttttctggaagaatctgagtgtctcagaggcaagaggaaaaattctc
cactatcaggtgaccttgcaggagctgacaggagggaaagttatgacacagaacatcaca
ggacacacctcctggaccacagtcatttctagaaccggaaattgggctgtggctgtgtct
gcagcaaattcaaaaggcagttctctgcccactcgtattaacataatgaacctgtgtgag
gcagggttgctagctcctcgccaggtctctgcaaactcagagagcatgggcaacattctg
gtgacttggcagcctcccaggaaagatctctctgctgtgcaggagtacgtggtggaatgg
agacagctccatccaggggatgacacacagatccctctaaactggctgcggagtccccct
tacaatgtgtctgctctgatttcagagaacataaaaccctacacctgttatgaaatccgt
gtgtatgcactctcagaggatcaaggaggatgcagctccatcctgggtaactctaagcac
aaagcaccactgagtggcccccatattaatgccatcacagaggaaaaggggagcatttta
atttcatggaacagcattccagtccaggagcaaatgggctgcctcctccattacaggata
tactggaaggaacgggactccaactcccagcctcagctctgtgaaattccctatagagtc
tcccaaaattcacatccaataaacagcctgcagccccgagtgacatatgtcctgtggatg
acagctttgacagctgctggcgaaagttcccaaggaaatgagagggaattttgtctgcaa
ggtaaagccaattggatggcgtttgtggcaccaagcatttgcattgctatcatcatggtg
ggcattttctcaatgcattacttccagcaaaagttatttgttctcctagcggccctcaga
cctcagtggtgtagcagagaaattccagatccagcaaatagcacttgcgctaagaaatat
cccattgcagaggagaagacacagctgcccttggacaggctcctgatagactggcccatg
cctgaagatcctgaacccctgatcatcagtgaagtccttcatcaagtgaccccagttgtc
agacgtccccactgctccaactggccacaaaggggaaaaggaacccaaggtcaccaggcc
tctgagaaagacatgatgcacagtgcctcaagcccaccacttccaagagctctcccagct
gagagcagacaactggtggatctgtacaaggtgctggagagcaggggttcctacccaaag
ccagaaaacccagccagtccctggacagtgcttccagcgggcaaccttcccacccacgat
ggctacttaccctccaacatagatgacctcccctcacatgaggtgcctctcactgactct
ctagaagaactggagcctcagcacatctccctttctgttttcccctcaagttctcttcac
ccactcaccttctcctgtggtgataagctgactctggatcagttaaagatgaggtgtgac
tccctcatgctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657311
Entry
104657311         CDS       T03989                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104657311 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104657311 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104657311 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657311 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104657311 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104657311 (IL23R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104657311 (IL23R)
SSDB
Motif
Pfam: IL12p40_C IL6Ra-bind fn3 Lep_receptor_Ig PriX
Other DBs
NCBI-GeneID: 104657311
NCBI-ProteinID: XP_010355381
UniProt: A0A2K6RJF1
LinkDB
Position
12
AA seq 629 aa
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATNFKMGMNISIYCQAAIKNCQ
PRQLHFYKNGIKERFEITRINKTTARLWYKNFLEPHASMYCTAECPNHFQETLICGKDIS
SGYPPDVPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAENALGMEESKQLQIHLDDIVIPSASIISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTDFTYVQQSEFYLEPNIKYIFQVRCQETG
KRYWQAWSSPFFHKTPETVPQVTSKSFQHDTWNSGLTVASISTGHLTSDNREDIGLLLGM
IVFAVMLSILSLIGIFNRSLRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENNELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENAGPLETRDYLQNSLFDNTTVVYIPDL
NTGYKPQISNFLPGRSHLSNNDEITSLTLKPPVDSLDSGNNPRSQKHPNFAFSVSSVNSP
SSTLFLGELSLILNQGECSSPDIQNSVEEESTMLLENDSPSETIPEQTLLPDEFVSCLGI
MNEELPSINSYFPQNILESHFKRISLLEK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgcggtaatagccctttacatactcttcagttgg
tgtcatggaggaattacaaatataaactgctctggccacatttgggtagaaccagccaca
aattttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggcaacttcatttttataaaaatggcatcaaagaaagatttgaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtcccaatcattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatgttcctgatgaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggtg
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtatttggtttgggtccaagcagaaaac
gcactaggcatggaagagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcatccatcatttccagggctgagactataaatgctacagtgcccaagaccataatt
tattgggacagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccgattttacatatgtgcaacagtca
gaattctacttggagccaaacatcaagtacatatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcaggcttggagttcaccgttttttcataaaacacctgaaacagttccc
caggtcacatcaaaatcattccaacacgacacatggaattctgggctaacggttgcttct
atctctacaggacaccttacttctgacaacagagaagacattggacttttattgggaatg
atcgtcttcgctgttatgttgtcaattctttctctgattgggatatttaacagatcactc
cgaactgggattaaaagaaggatattattgttaataccaaaatggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaataatgaacttatgaat
aataattccagtgagcaggtcctatatgttgatccaatgattacagagataaaagaaatc
tttatcccagaacacaagcctacagactacaagaaggagaatgcaggacccctggagaca
agagactacctgcaaaactcgctatttgacaatactacagttgtgtatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctgggagaagccatctcagcaat
aatgatgaaatcacttccttaacacttaaaccaccagttgattccttagactcaggaaat
aatcccaggtcacaaaagcatcctaattttgctttttctgtttcaagcgtgaattcacct
agcagcacgctatttcttggagaattaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaagcaccatgcttttggaaaacgattcaccc
agcgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
atgaatgaggagttgccatctattaattcttattttccacaaaatattttggaaagccac
ttcaaaaggatttcactcttggaaaagtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657349
Entry
104657349         CDS       T03989                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha isoform X2
  KO
K05067  interleukin 5 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104657349 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104657349 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104657349 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657349 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104657349 (IL5RA)
   04090 CD molecules [BR:rro04090]
    104657349 (IL5RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104657349 (IL5RA)
CD molecules [BR:rro04090]
 Proteins
  104657349 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac EpoR_lig-bind
Other DBs
NCBI-GeneID: 104657349
NCBI-ProteinID: XP_010355432
UniProt: A0A2K6PU38
LinkDB
Position
1
AA seq 397 aa
MIIMAPVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLHWEPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHD
PPGSPGTSVVNLTCTTNTIADNYSHLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDSLGRNIACWFPRTFIRSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDRIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLREWFLIVLMATICFILLILLL
ICRICHLWIKLFPPIPAPKSSIKDLFVTANYEKAGSC
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgatcatcatggcacctgtattactgatacttttgggggccactgagatactgcaagct
gacttacttcctgatgaaaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacattgggaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaatgctccaaaagaagatgattatgaaaccaga
atcactgaaagcaaatgtgtaaccatcctccacaaaggcttttcagcaagtgtgaggacc
atcttgcagaacgaccactcactcctggccagcagctgggcttctgctgaacttcatgac
ccaccagggtctcccggaacctcagttgtgaatttaacttgcaccacaaacactatagca
gataattattcacatttaaggccataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagactcactggggagaaacatcgcatgctggtttcccagg
acttttatccgcagcagagggcgtgactggcttgcggtgcttgttaacggctccagcaag
cactctgccatcaagccctttgatcagctgtttgcccttcacgccattgatcgaataaat
cctccactgaatgtcacagcagagattgaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcctttccaatccattgctttgattatgaagtaaaaatacacaatgcaagg
aacggatatttgcagatagaaaaaatgatgaccaacgcattcatctcaataattgatgat
ctttctaagtatgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcgggg
ctctggagtgagtggagccaacctatttatgtgggaaaagatgaacacaagcccttgaga
gagtggtttctcattgtgcttatggcaaccatctgcttcatcttgttaattctcttgctc
atctgtagaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
agtatcaaagatctctttgtaaccgctaactatgagaaagctggttcctgttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658748
Entry
104658748         CDS       T03989                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05160  Hepatitis C
rro05162  Measles
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658748 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    104658748 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104658748 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104658748 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104658748 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    104658748 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    104658748 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104658748 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658748 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104658748 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    104658748 (IFNAR2)
   05164 Influenza A
    104658748 (IFNAR2)
   05162 Measles
    104658748 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    104658748 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104658748 (IFNAR2)
   05169 Epstein-Barr virus infection
    104658748 (IFNAR2)
   05165 Human papillomavirus infection
    104658748 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104658748 (IFNAR2)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IFN receptor family
   104658748 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind MutH
Other DBs
NCBI-GeneID: 104658748
NCBI-ProteinID: XP_010357127
UniProt: A0A2K6PSG8
LinkDB
Position
13
AA seq 516 aa
MLLSQNAFIVRPLNLFLMVCINLVFGISHDLPDDTSASCTFKISLRNFRSILSWELKNHS
IVATHYTLLYTIMSKPEDLKMVKNCANTTRSFCDLTDEWRSTHEAYVTIVKGFSGNTTLF
SCSHNFWLDIDMSFEPPEFEIVGFTNHINVIVKFPSIVKEESQFDLSLVIEEQSEGIVKK
HKPAIKGNMSGNFTYIIDKLIPNANYCVSVYFEHNDEQAVIKSPLKCTLLQPGQESESAE
SAKVGGIITVFLMALALISTIVTLKWIGYICLRNSLPKVLNFHNFLAWPFPNLPPLEAMD
IVEVIYINRKKKVWDYNYDDESDSDTEAAPRTNGGGYTMHGLTIRPLGQASATSTESQFM
DPDSEEEPDLPEVDVELPTTPKRSPQQLELLSAPCERRESPLQDPFPEDDYSSTEGSGGR
ITFNVDLNSVFLRVLDDEDSDDLEEAPLMISSHLEEMVDPEDPDNVQSSHLLASGEGTQP
TLPSPSSEGLQSEDAPSDQSDTSESDVDLGDGYIMR
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgccttcatcgtcagaccacttaatttgtttctcatggtgtgt
atcaacctcgtgtttggtatttcacatgatttgcctgatgacacaagtgcatcttgcact
tttaagatatcattgcgaaatttccggtccatcttatcatgggaattaaaaaaccactcc
attgtggcaactcactatacgttgctgtatacaatcatgagtaaaccagaagatttgaag
atggttaagaactgtgcaaataccacaagatcattttgtgacctcacagatgagtggaga
agcacacacgaggcctatgtcaccatcgtaaaaggattcagcgggaatacaaccttgttc
agttgctcacacaatttctggctggacatagacatgtcttttgaaccgccagagtttgag
attgttggttttaccaaccacattaatgtgatcgtgaaatttccatctattgttaaagaa
gaatcacagtttgatttatcacttgtcattgaagaacagtcagaggggattgttaagaag
cataaacctgcaataaaaggaaacatgagtggaaatttcacctatatcattgacaagtta
attccaaatgcaaactactgtgtatctgtttatttcgagcataacgatgagcaggcagta
ataaagtctcccttaaaatgcaccctccttcaacctggccaggaatcagaatcagcagaa
tctgccaaagtaggaggaataattactgtgtttttgatggcattggccttgataagcacc
atagtgacactgaaatggattggttatatatgcttaagaaacagcctccccaaagtcttg
aattttcataactttttagcctggccatttcctaacctgccaccgttggaagccatggat
atagtggaggtcatttacatcaacagaaagaagaaagtgtgggattataattatgatgat
gaaagtgacagcgatactgaggcagcgcccaggacaaatggcggtggctataccatgcat
ggactgactatcaggcctctgggtcaggcgtccgccacctctacagaatcccagtttatg
gacccagactccgaggaggagcctgacctgcctgaggttgatgtggagctccccacgacg
ccaaagcgcagccctcagcagttggagctcttgagtgcgccctgtgagaggagagagagt
ccactccaggacccctttcccgaagacgactacagctccactgaggggtctgggggcaga
attaccttcaatgtggatttaaactctgtgtttttgagggttcttgatgatgaggacagt
gatgacttagaagaagcccctctgatgatatcatctcatctggaagagatggttgaccca
gaggatcctgacaatgtgcagtcaagccatttgctggccagtggggaagggacacaacca
acccttcccagcccctcttcagaaggcctgcagtctgaagatgctccatctgatcaaagt
gacacttctgagtcagatgttgaccttggggatggttatataatgagatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658749
Entry
104658749         CDS       T03989                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X2
  KO
K05135  interleukin 10 receptor beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658749 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104658749 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104658749 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104658749 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104658749 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104658749 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104658749 (IL10RB)
   04090 CD molecules [BR:rro04090]
    104658749 (IL10RB)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104658749 (IL10RB)
CD molecules [BR:rro04090]
 Proteins
  104658749 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 104658749
NCBI-ProteinID: XP_010357134
LinkDB
Position
13
AA seq 327 aa
MGICFEEKGCKCFSRMFIALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLS
YRIFQDKCPSTTLMECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGM
QVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVL
RNLEPWTTYCVQVQGFLPDRNKTGEWSEPVCEQTTSDETVPSWMVAIILMASVFVVCLAL
LGCFALLWCIYKKTKYTFSPGNSLPQHLKEFLGHPHHNTLLFFSFPFSDENDVFDKLSVI
AEESESSKQNPDDSCSLGTPPGQGPQS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggtatctgttttgaggaaaaaggttgtaaatgtttttctcgtatgttcatagcattg
ggaatggtaccacctcctgaaaatgtcagaatgaattctgttaatttcaagaacattcta
cagtgggagtcacctgcttttgccaaagggaacctgactttcacagctcagtacctaagt
tataggatattccaagataaatgcccgagtactaccttgatggaatgtgatttctcaagt
ctttccaagtatggtgaccacaccttgagagtcagggctgaatttgcagatgagcattca
gactgggtaaacatcaccttctgtcctgtggatgacaccattattggaccccctggaatg
caagtagaagtccttgctgattctttacatatgcgtttcttagcccctaaaattgaaaat
gaatacgaaacttggactatgaagaatgtgtataattcatggacttataatgtgcaatat
tggaaaaatggtactgatgaaaagtttcaaattactcctcagtatgactttgaggtcctc
agaaacctggagccatggacaacttactgtgttcaagttcaagggtttcttcctgatcgg
aacaaaactggggaatggagtgagcctgtctgtgagcaaacaaccagtgacgaaacggtc
ccctcctggatggtggccatcatcctcatggcctcggtcttcgtggtctgcctggcactc
cttggctgcttcgccttgctgtggtgcatttataagaagacaaagtacaccttctcccct
gggaattctcttccacagcacctgaaagagtttttgggccatcctcatcataacacactt
ctgtttttctcctttccattctcggatgagaatgatgttttcgacaagctaagtgtcatt
gcagaagagtctgagagcagcaagcagaatcctgatgacagctgcagcctcgggaccccg
cctgggcagggaccccagagctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658750
Entry
104658750         CDS       T03989                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1 isoform X1
  KO
K05130  interferon receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658750 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    104658750 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104658750 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104658750 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104658750 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    104658750 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    104658750 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104658750 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658750 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104658750 (IFNAR1)
   05160 Hepatitis C
    104658750 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    104658750 (IFNAR1)
   05164 Influenza A
    104658750 (IFNAR1)
   05162 Measles
    104658750 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    104658750 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104658750 (IFNAR1)
   05169 Epstein-Barr virus infection
    104658750 (IFNAR1)
   05165 Human papillomavirus infection
    104658750 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104658750 (IFNAR1)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IFN receptor family
   104658750 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 104658750
NCBI-ProteinID: XP_010357136
UniProt: A0A2K6PT61
LinkDB
Position
13
AA seq 558 aa
MMVTLLGATTLVLVTLAPWVLSAAAGGKNLKSPQKVEVDIIDDTFILRWNRSDESVGNVT
FSFDYQKPGMDNWIKLPGCQNITSTKCNFSSLKLNIYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPPGTKDSVMWALDGLSFTYSLVIWKNSSSVEER
IENIYSRHKIYKLSPETTYCLKVKAALLTSRKIGVYSPVHCIKTTVENELPPPENIEVIV
QNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIRECENVKATQCVFPQNIFQ
KGIYLLRVQASDGKNTSFWSEEIKFDTEIQASLLPPVFNVRSLSDSLCISIGAPQRSENK
PVIQDYPLIYEILFWENTSKAERKIIEKKTDVTIPNLKPLTVYCVKARAHSMDEKLNKSS
VFSDVVCEETKSGNTSKIWLIIGIFTVLLALPFVIYAVKVLLRCINYVFFPSLKPSSNIE
EYFSEQPLKNLLLLTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYS
NEDESENKTSEELQQDFI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgatggtcaccctcctgggcgcgacgaccctagtgctcgtcaccttggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggttgacatc
atagatgacacgtttatcctgaggtggaacaggagtgatgaatctgtcgggaatgtgact
ttttcgttcgattatcaaaaacctgggatggataattggataaaattgcctggatgtcag
aatattactagtaccaaatgcaacttttcttcgctcaagctgaacatttatgaagaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgactcattt
acaccatttcgcaaagctcaaattggtcctccggaagtacatttagaagctgaagataag
gcaatagtgatacacatctctcctcctggaacaaaagatagtgtcatgtgggctttggat
ggtttaagctttacatatagcttagttatctggaaaaactcttcaagtgtagaagaaagg
attgaaaatatttattccagacataaaatttataaactctcaccagagactacttattgt
ttaaaagttaaagcagcactacttacgtcaaggaaaattggtgtctatagtccagtacat
tgtataaagaccacagttgaaaatgaactacctccaccagaaaatatagaagtcattgtt
caaaatcagaactatgttcttaaatgggattatacatatgcaaacatgacctttcaagtt
cagtggctccatgcctttttaaaaaggaaccctggaaaccatttgtataaatggaaacaa
atacgtgagtgtgaaaatgtcaaagcgacccagtgtgtctttcctcaaaacattttccaa
aaaggaatttaccttctccgtgtacaagcatctgatggaaagaacacgtctttttggtct
gaagagataaagtttgatactgaaatacaagcttccctactcccgccagtctttaacgtt
agatcccttagtgattcattatgtatctccatcggtgctccacaacggtctgaaaacaaa
cctgtgatccaggattatccactgatttatgaaattcttttttgggaaaacacttcaaag
gctgagagaaaaattatcgagaaaaaaactgatgttactattcctaatttgaaaccactg
actgtatattgtgtgaaagccagagcacacagcatggatgaaaagctgaataaaagcagt
gtttttagtgatgttgtgtgtgaggaaacaaaatcaggaaatacatctaaaatttggctt
ataattggaatttttactgtattacttgctctcccatttgtcatttatgctgtgaaagtc
ctcttgagatgcatcaattatgtcttctttccatcacttaaaccttcttccaatatagag
gagtatttctctgaacagccattgaagaatcttctgcttttaacttctgaggagcaaatc
gaaaaatgttttataattgaaaatataagcacaattgctacagtagaagaaactaatcag
actgatgaagatcataaaaaatacagttcccaaaccagccaagattcaggaaattattct
aatgaagatgaaagtgaaaataaaacaagtgaagaactacagcaggactttatatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658778
Entry
104658778         CDS       T03989                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2 isoform X1
  KO
K05133  interferon gamma receptor 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04066  HIF-1 signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05164  Influenza A
rro05168  Herpes simplex virus 1 infection
rro05200  Pathways in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658778 (IFNGR2)
   04066 HIF-1 signaling pathway
    104658778 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104658778 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104658778 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104658778 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    104658778 (IFNGR2)
   04659 Th17 cell differentiation
    104658778 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104658778 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658778 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104658778 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104658778 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104658778 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    104658778 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    104658778 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104658778 (IFNGR2)
   05140 Leishmaniasis
    104658778 (IFNGR2)
   05142 Chagas disease
    104658778 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104658778 (IFNGR2)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IFN receptor family
   104658778 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 104658778
NCBI-ProteinID: XP_030770064
LinkDB
Position
13
AA seq 340 aa
MEFQIKEKRKRPGVVAHTCNPSTLGGRDPLSQLPTPQHPKIRLYNAEQVLSWEPVALSNS
TRPVVYRVQFKYTDSEWFMTDVMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRA
ELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFWYHV
HYWEKGGIQQVKGPFRSNSISLDNLKPFRVYCLQVQAQLLWNKSNILRLGHLSNTSCYET
MADASTELQQVILISVGTFSLLSVVAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKD
PTQPILEALDKDSSPKDDVWDSVSIISFPEKEQDDVLQTL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagtttcagattaaagaaaagaggaaaaggccaggcgtggtggctcatacctgtaat
cccagtactttgggaggccgagaccctctttcccagctgcccactcctcagcacccgaag
attcgcctgtacaacgcagagcaggtcctgagttgggagccagtggccctgagcaatagc
acaaggcctgttgtctaccgagtgcagtttaaatacaccgatagtgaatggttcatgacc
gacgtcatgtccataggggtgaattgtacacagatcacagcaacagagtgtgacttcact
gccgccagcccctcagcaggcttcccaatggatttcaatgtcactctacgccttcgagct
gagctgggagcactccattctgcctgggtgacaatgccttggtttcaacactatcggaat
gtgactgtcgggcctccagaaaacattgaggtgaccccaggagaaggctccctcatcatc
aggttctcctctccctttgacatcgctgatacctccacagcctttttttggtatcatgtc
cattactgggaaaaaggaggcatccaacaggtcaaaggccctttcagaagcaactcgatt
tcattggataacttaaaacccttcagagtgtactgtttacaagtccaggcacaactgctt
tggaacaaaagtaacatcttgagactggggcatttaagcaacacatcttgctacgaaaca
atggcagatgcctccactgagcttcagcaagtcatcctgatctctgtgggaacattttca
ttgctgtcggtggtggcaggggcctgtttcttcctggtcctgaaatacagaggcctgatt
aaatattggtttcacactccaccaagcattccgttacagatagaagagtatttaaaggac
ccaacccagcccatcttagaggccttggacaaggacagctcaccaaaggatgatgtctgg
gactctgtgtccatcatttcctttccagaaaaggagcaagatgatgttctccaaacactt
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658857
Entry
104658857         CDS       T03989                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04630  JAK-STAT signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104658857 (PDGFRA)
   04014 Ras signaling pathway
    104658857 (PDGFRA)
   04015 Rap1 signaling pathway
    104658857 (PDGFRA)
   04630 JAK-STAT signaling pathway
    104658857 (PDGFRA)
   04020 Calcium signaling pathway
    104658857 (PDGFRA)
   04072 Phospholipase D signaling pathway
    104658857 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    104658857 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104658857 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104658857 (PDGFRA)
   04540 Gap junction
    104658857 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104658857 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658857 (PDGFRA)
   05206 MicroRNAs in cancer
    104658857 (PDGFRA)
   05230 Central carbon metabolism in cancer
    104658857 (PDGFRA)
   05231 Choline metabolism in cancer
    104658857 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    104658857 (PDGFRA)
   05218 Melanoma
    104658857 (PDGFRA)
   05215 Prostate cancer
    104658857 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104658857 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104658857 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104658857 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rro04090]
    104658857 (PDGFRA)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104658857 (PDGFRA)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104658857 (PDGFRA)
CD molecules [BR:rro04090]
 Proteins
  104658857 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 104658857
NCBI-ProteinID: XP_010357288
UniProt: A0A2K6QIB8
LinkDB
Position
2
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGDSEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccagcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcgttaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggatagtgaagtgagctggcagtacccc
atgtctgaagaagagaactctgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacagtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcattgtg
gaggacgatgattctgccatcataccttgtcgcacaactgatcccgagactcctgtaact
ttacacaacagcgagggggtggtacctgcctcctacaacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagagagtcactatttctgttcatgagaaagggttcattgaaatcaaacccacc
tttagccagctggaagctgtcaacctgcatgaagtcaaacattttgtcgtagaggtgcag
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgatcgaaaatctc
acggagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
cttatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gatgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gtcgatgatcaccatggctcaactgggggacagacggtgaggtgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccttgtgacttttgccaaagtggaagagaccattgcggtgaga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgctggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccagatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcatttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacataatcacggagtactgcttctacgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccagagaag
ccaaagaaagagctggatatctttgggttgaaccctgctgatgacagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctgtatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggatctggct
gctcgcaacgtcctcctggcacaaggaaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtatcgaaaggcagcacctttctgcctgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggtactccttaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctatgagatcatggtgaaatgctggaacagtgagccagagaagaga
ccctctttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcatctggatttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagcggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659540
Entry
104659540         CDS       T03989                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor isoform X2
  KO
K05073  interleukin 9 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659540 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659540 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659540 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104659540 (IL9R)
   04090 CD molecules [BR:rro04090]
    104659540 (IL9R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104659540 (IL9R)
CD molecules [BR:rro04090]
 Proteins
  104659540 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 104659540
NCBI-ProteinID: XP_010357900
UniProt: A0A2K6RJS7
LinkDB
Position
7
AA seq 514 aa
MGLGRCIWKGWTLESEALRRDMGTWLLACTCVCTCVCLGVSVTGEGRGPRAGNFTCLNNN
ILRIDCRWSAPELSQGSSPWLLFTSNQAPGGTHKCILQGSECTVVLPPEAVLVPSDNFTI
TFHHCVSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLS
YELAFKKQEEAWERAQHRDHIVGVTWLVLEAFELHPGFIHEARLRVQMATLEDDVAEEER
YTSQWSEWSQPVCFQAPQRQGPLIPPWGQPDNTLVAVSVFLLLIGLTYLLFKLSPRVKRI
FYQNVPSPAAFFRPLYSVHNGNFQTWMGAHRAGVLLSQDCAGTPQGASEPCIQEAVALLT
CGPVHPWKSVALEEEEEGTGTRLPGNRSSENVLPAGCMGWRAQTLAYLPQEDWAPTSPTG
SAPPDSEGSSSSSSDYCALGCYGGWHLSALPGNTQSPGPIPALACGLSCDHQGLETQQGV
AWVLAGHCQRPGLHENLQGMLLPSVLSKARSWTF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgggactgggcagatgcatctggaaaggctggaccttggagagtgaggccctgaggcga
gacatgggcacctggctcctggcctgcacctgcgtctgcacctgtgtctgcttgggagtc
tctgtcacaggggaaggacgagggccaagggctggaaacttcacctgcctcaacaacaac
attctcaggatcgattgccgttggtctgccccagagctgagccagggctccagcccctgg
ctcctcttcaccagcaaccaggctcccggcggcacacataagtgcatcttgcagggcagt
gagtgcaccgtagtgctgccacccgaggcagtgctcgtgccatctgacaatttcaccatc
actttccaccactgcgtgtctggcagggaacaggtcagcctggtggacccggagtacctg
ccccggagacacgtgaagctggacccgccctctgacttgcagagcaacatcagctctggc
cactgcatcctgacctggagcatcagtcctgccttggagccaatgaccacacttctcagc
tatgagttggccttcaagaagcaggaagaggcctgggagcgggcccagcacagggatcac
attgtcggggtgacctggctcgtacttgaagcctttgagttgcaccctggctttatccat
gaggccaggctgcgtgttcagatggccacactggaggatgacgtggcagaggaggagcgt
tacacaagccagtggagcgagtggagccagcctgtgtgcttccaggctccccagagacaa
ggccctctgatcccaccctgggggcagccagacaacacccttgtcgctgtgtccgtcttc
ctcctgctgattggcctgacttacctcctgttcaagctttcacccagggtgaagagaatc
ttctaccagaacgtgccctctccagcggcgttcttccggcccctctacagtgtgcacaat
gggaacttccagacttggatgggggcccacagggccggtgtgctgctgagccaggactgt
gctggcaccccacaaggagcctcggagccctgcatccaggaggccgtcgcactgctcacc
tgtggcccagtgcatccttggaaatctgtggccctggaggaggaagaggagggcactggg
accaggcttccagggaaccggagctcagagaatgtgctgccagcagggtgtatggggtgg
agggcacagacccttgcctatctgccacaggaggactgggcccccacgtcccccaccggg
tcagctcctccagactcagagggcagcagcagcagcagcagtgactactgtgctttgggc
tgctatgggggatggcacctctcagccctcccagggaacacgcagagccctgggcccatc
ccagccctggcttgtggcctttcctgtgaccatcagggcctggagacccagcaaggagtt
gcctgggtgctggctggccactgccagaggcctgggctgcatgagaacctccagggcatg
ttgctcccttcagtcctcagcaaggctcggtcctggacattctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660161
Entry
104660161         CDS       T03989                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104660161 (CSF3R)
   04151 PI3K-Akt signaling pathway
    104660161 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104660161 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104660161 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660161 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104660161 (CSF3R)
   04090 CD molecules [BR:rro04090]
    104660161 (CSF3R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  Prolactin receptor family
   104660161 (CSF3R)
CD molecules [BR:rro04090]
 Proteins
  104660161 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 104660161
NCBI-ProteinID: XP_010358737
UniProt: A0A2K6R081
LinkDB
Position
12
AA seq 836 aa
MARLRTCSLTWAALIILLLPGSLEECGHVSVSAPIVHLGDPITASCIIKQNCSHLDLEPQ
ILWRLGAELQPGGRQQRLSDGTQQSTITLPHLNHTRAFLSCCLNWGNSLQILDQVELRAG
YPPAIPRNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPE
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLQPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPALHINQKCELRHKPQSGEASWALVGPLPLEALRYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLNTWWRQRQLDPRTVQLFWKPVP
LEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFPLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMAQDPHSLWVGWEPPSPWPQGYVIEWGLSPPSTSNSNKTWRME
QNGSATGFLLQENIRPFQLYEITVTPLYQDAMGPSQHVYAYSQEMAPCHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNTQNQSFSTILNASSHGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLIPEGSELHILLGLFGLLLLLSCLCGTAWLCCSPSRKNPLWP
SVPDPAHSSLGSWVPTIMEEEAFQLPGLGMPPITKLTVLEEDEKKPLPWESHNSSETCGL
PTLVQTYVLQGDPRAAPTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLDFPLLQGIRVHGVEGLESF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgagaacctgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacgtcagtgtctcagcccccattgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacctggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggacccagcaatctaccatcaccctgccccacctcaaccacactcgggcctttctttcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgtgcaggc
taccctccagccataccccgcaacctctcctgcctcatgaacctcacaaccagcagcctc
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagc
ttcaagagccggggcaactgtcagacccaaggggactccatcctggactgcgtgcccgag
gacgggcagagccactgctccatcccacgcagacacctgctgttgtaccagaatatgggc
atctgggtgcaggcggagaatgcgctggggaccagcatgtccccacaactgtgccttcag
cccatggacgttgtgaaactggagccccccatgctgcggaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagttgtgctgggagccatggcagccagccctg
cacataaatcagaagtgtgagctgcgccataagccgcagagtggagaagccagctgggca
ctggtgggccccctgccattggaggcccttcggtatgagctctgtgggctcctaccagcc
acggcctacaccctgcagatacgctgcatccgctggcccctgcctggccactggagcgac
tggagtcccagcctggagctgagaactactgaacgggcccccactgtcagactgaacaca
tggtggcggcagaggcagctggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacagatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccccctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctcccgtcccacc
ccggtggtcttctcagagagcagaggcccagccctgaccagactccatgccatggcccaa
gaccctcacagcctctgggtgggctgggagccccccagtccatggcctcagggctatgtg
attgagtggggactgagcccccccagcacgagcaatagcaacaagacctggaggatggaa
cagaatgggagcgccacggggtttctgctgcaggagaacatcaggccctttcagctctat
gagatcactgtgactcccttgtaccaggacgccatgggaccctcccagcatgtctatgcc
tactcccaagaaatggccccctgccatgccccagagctgcatctaaagcacattggcaag
acctgggcacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaatactcaaaaccagtcgttctccaccatcctgaatgcc
tcttcccatggctttgtcctccatggcctggagcccgccagtctgtatcacattcacctc
atggctgccagccaggccggggccaccaacagtacagtcctcaccctgatgaccttgatc
ccagagggatccgagctacacatcctcctgggcctgttcggcctcctgctcttgctctcc
tgcctctgtggaactgcctggctctgctgcagccccagcaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctgggctcctgggtgcccactatcatggaagag
gaggccttccagctgcccggcctcggcatgccacccatcaccaagctcacagtgctggag
gaggacgagaagaagccactgccctgggagtcccataacagctcagagacctgtggcctc
cccactctggtccagacctatgtgctccagggggacccaagagcagctcccacccagccc
caatcccagtccggcaccagcgatcaggtcctctacgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgcgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccctggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcgacttcccc
ctcctgcaggggatccgggtccatggggtggaggggctagagagcttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661055
Entry
104661055         CDS       T03989                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661055 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661055 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104661055 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104661055 (IL27RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104661055 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 104661055
NCBI-ProteinID: XP_010359891
UniProt: A0A2K6Q9C0
LinkDB
Position
8
AA seq 636 aa
MRGGRGAPFWPWPLPKLALLPLLWVLFQRTRPQGSARPLQCYGVGPLGDLNCSWEPLGDL
GAPSELHFQSQKYHSNKTQTVAVAARQSWVAIPREQLTMSDKLLVWGTKAGQPLWTPVFV
NLETQMKPNAPRLGPEVDVSEDEPLEAIVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE
LELRTIPLAPVEIQDLELATGYQVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSG
NLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGVTCCCSLIPSGAEWARVSA
INATSWEPLTNLSLVCLDSASAPHSVAVSSIAGSTELLVTWRPGPGEPRQHVVDWTRDGD
PLEKLNWVRLPPGNFSALLPGNFTVGVPYRITVTAVSASGLAPAPPIWGFREELAPLVGP
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQGGISPSVCMNLSGNTHSVTLPDL
PWGPCQLWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLMGCGLSLATSG
RCYHLWHKVLPRWVWEKVPDPANSSSGQPHMEQVPEVQPLGDLPILEVEEMEPPPVMESS
QPPQVTAPLDSGYEKHFLPTPEELGLLGPPRPQVLA
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgcggggaggcaggggcgcccctttctggccgtggccgctgcccaagctggcgctgctg
cctctgctgtgggtgcttttccagcggacgcgtccccagggcagcgccaggccactgcag
tgctacggagttggacccttgggcgacttgaactgctcgtgggagccacttggggaccta
ggagccccctccgagttacacttccagagccaaaagtaccattccaacaaaacccagact
gtggcagtggcagccaggcagagctgggtggccattcctcgggaacagctcaccatgtct
gacaagctccttgtctggggcactaaggcaggccagcctctctggacccccgtcttcgtg
aacctggaaacccaaatgaagccaaatgccccccggctgggccctgaggtggacgtttcc
gaggatgagcccctggaggccattgtccattgggccccacctacatggccgtctcataaa
gttctgatctgccagttccactaccgaagatgtcaggaggcagcctggaccctgctggaa
ctggagctgaggaccatacccctggcccctgttgagatccaagatttggagctagccact
ggctaccaagtgtatggccgctgccgaatggagaaagaagaggatttgtggggcgagtgg
agccccattttgtccttccagacaccgccttctgctccaaaagatgtgtgggtatcaggg
aacctctgtgggacgcctggaggagaggaacccttgcttctgtggaaggccccagggccc
tgtgtgcaggtgagctacaaagtctggttctgggttggaggtcgtgagctgagtccggaa
ggagttacctgctgctgctcccttattcccagcggggcagagtgggccagagtgtccgct
atcaacgccacaagctgggagcctctcaccaacctctctttggtctgcttggattccgcc
tctgcccctcatagcgtggcggtcagcagcatcgctgggagcacggagctactggtgacc
tggcgaccggggcctggggagccacggcagcatgtagtggactggactcgagatggggac
cccctggagaaactcaactgggtccggcttcccccggggaacttcagtgctctgttaccg
gggaatttcacagtcggggtcccctatcgaatcactgtgaccgcagtttctgcttcgggt
ttggcccctgcaccccccatctgggggttcagagaggaactagcacccctagtggggcca
acgctttggcgactccaggatgcccctccagggacccccgccatagcgtggggagaggtc
ccaaggcaccagcttcgaggacacctcacccactacaccttatgtgcccagggtggaatc
agcccctccgtctgcatgaatttgagtggcaacacacacagtgtcaccctgcctgacctt
ccttggggtccctgtcagctgtgggtgacagcatctaccatcgctggacagggccctcct
ggtcccatcctccggcttcatctaccagataacaccctgaggtggaaagtcctgccaggc
atcctgttcttgtggggcttgttcctgatggggtgtggtctgagcctggccacctctgga
aggtgctaccacctatggcacaaggtgctgccccgctgggtctgggagaaggttcctgat
cctgccaacagcagttcaggccagccccacatggagcaagtgcctgaggtccagcccctt
ggggacttgcccatcctggaagtggaggagatggagcccccgccggttatggagtcctcc
cagcccccccaggtcaccgccccgcttgactctgggtatgagaagcacttcctgcccaca
cctgaggagctgggccttctgggtcccccccggccacaagttctggcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662030
Entry
104662030         CDS       T03989                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04068  FoxO signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
rro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104662030 (IL7R)
   04068 FoxO signaling pathway
    104662030 (IL7R)
   04151 PI3K-Akt signaling pathway
    104662030 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104662030 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104662030 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662030 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    104662030 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104662030 (IL7R)
   04090 CD molecules [BR:rro04090]
    104662030 (IL7R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104662030 (IL7R)
CD molecules [BR:rro04090]
 Proteins
  104662030 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 104662030
NCBI-ProteinID: XP_010361212
UniProt: A0A2K6QXN5
LinkDB
Position
3
AA seq 459 aa
MTILGTTFGIVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMH
VNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTSEINNSPGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDRFPQQLEESKKQRLGRDVQSPSCPSEDVGITPES
FERDSSLRCLAGNVSACDAPILSSSRSLDCRESSKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatagttttttctttacttcaagtcgtttctgga
gaaagtggctatgcgcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcccagcactcactgacctgtgcttttgag
gacccagatgtcaacaccaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgagtttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggaggaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctaagtgtcgtctatcgt
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcatgatgtagcttaccgccaggaaaaggatgaaaacaaatggatgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaacctccaacctgaagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaacttcagagatcaacaatagcccaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtggctctgttggtcatcttggcc
tgtgtgttatggaaaaaaagaattaagcctatcgtatggcccagtctccctgatcataag
aagactctggagcatctttgtaagaaaccaagaaagaatttaaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagataggtttcctcagcaactagaagaatctaagaagcagaggctt
ggaagggatgtgcagagccccagctgcccatctgaggatgtgggcatcaccccagaaagt
tttgaaagagattcatccctcagatgcctggctgggaatgtcagtgcatgtgatgcccct
atactctcctcttccaggtccctagactgcagggagagtagcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcaccctgccccctccattttct
ctccaatccggaatcctgacgttgaacccagttgctcaagggcagcccattcttacttcg
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663343
Entry
104663343         CDS       T03989                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663343 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104663343 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104663343 (CRLF2)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104663343 (CRLF2)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 104663343
NCBI-ProteinID: XP_010362780
LinkDB
Position
22
AA seq 394 aa
MSHERSVGGRFLRTSLSTPVSGMGRFVLLGAAAVFLLGGWMALGQVGTGEGVKIQIIYFN
LETVQVTWNASHYPRSNLTFHYTLNPDEAYDQCTIYILQEGHNSGCLLDAEQQDDILYFS
IRNGTHPVFTASRWIYYYLKPGSPKQVSFSWHQDAVTVTCSDLSYRGLLYEVQYRSPFDT
EWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDVYGPDTYPSDWSEVTCWQRGETRDSC
PQTPTPPKPKLSKFILVSSLAILLMVSLLLLSLWKLWRVKKFLMPSVPDPKSTFPGLFEI
HQGNFQEWITDTQNVAHLPKMAGAEPESGPEDSLVVQLAKTEADAPRTLEPQTEEKEAAG
GSLQLPHQPPLPGGDVVTLGGFTFVMNDSSYVAL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgagtcacgagcgatctgttggtggcaggttcctgaggacctcactctccactcctgtt
tcaggcatgggacggttcgttctgctgggggcagctgctgtctttctgctgggaggctgg
atggctttggggcaagtgggaacaggagaaggcgtaaagattcagatcatctactttaat
ttagaaacggtgcaggtgacatggaatgccagccattaccccaggagcaatctgactttc
cactacacattgaatccagatgaggcctatgaccagtgcaccatctacattctccaggaa
ggtcacaattcggggtgcctcctagacgcagagcagcaagacgatattctctatttctcc
atcaggaacgggacgcaccccgttttcaccgccagtcgctggatctattattacctaaag
cccggttcgccgaagcaggtgagcttttcgtggcatcaggacgcggtgacggtgacgtgc
tctgacctgtcctacaggggtctcctctatgaggttcagtaccggagccccttcgacacg
gagtggcagtccaaacaggaaaatacctgcaatgtcaccatagaagatttggatgctgag
aagtgttacgctttccgggcccgggtgaaggccatggaggatgtatatgggccagacacg
tacccgagtgactggtcagaggtgacgtgctggcagagaggcgagactcgggattcgtgc
ccacagacacccacgcctcccaaaccaaagctgtccaaatttattttagtttccagcctg
gccatccttctgatggtatctcttctccttctgtctttatggaaattatggagagtgaag
aagtttctgatgcccagcgtgccagacccgaaatccaccttccctgggctctttgagata
caccaagggaacttccaggagtggatcacagacacccagaacgtggcccacctccccaag
atggcaggtgcagagccagaaagtggccctgaggactccctggtggtccagttggccaag
acggaagccgacgcacccaggacgctggagccacagaccgaggagaaagaggctgctggg
ggatccctccagcttccccaccagccgcccctgccaggcggtgatgtggtcactcttggg
ggctttacctttgtgatgaacgacagctcgtatgtggccttatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663344
Entry
104663344         CDS       T03989                                 

Gene name
CSF2RA
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663344 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104663344 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104663344 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663344 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104663344 (CSF2RA)
   04090 CD molecules [BR:rro04090]
    104663344 (CSF2RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104663344 (CSF2RA)
CD molecules [BR:rro04090]
 Proteins
  104663344 (CSF2RA)
SSDB
Motif
Pfam: IL6Ra-bind
Other DBs
NCBI-GeneID: 104663344
NCBI-ProteinID: XP_030782188
LinkDB
Position
22
AA seq 260 aa
MQTWELFLSEGWCIPASMGATRRREIQCPYYIEDSGTHVGCHLGNLSGLTSRNYFLVNGT
SQEIGIQFFDSLLDTKKIERFNPPGNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDV
HRKNTQPGTENLPINVSGDLENRYNFPSSEPRAKHAVKIRAADVRILNWSSWSEATEFGS
DDRNPSSVHIYVLLILGTLVCGLVFGFLFKRVQRLFPPVPQIKDKLNDNHDVEDEIIWEE
FTPEEGKSYREEVLTVKEIT
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcagacgtgggaactgtttcttagcgagggctggtgcatcccggccagcatgggtgct
accaggaggagggagatccagtgtccttattacatagaagactcaggaacccacgtgggg
tgtcacctgggtaacctgtcaggattaacctctcgcaattacttcctggttaacggaacc
agccaagaaattggcatccaattcttcgattcacttttggacacaaagaaaatagaacga
tttaacccgcccggtaatgtcactgtccgctgcaacacgacgcactgcctcgtacggtgg
aaacagcccaggacctatcagaagctgtcgtacttggactttcagtaccagctggacgtc
cacagaaagaatacccagcctggcactgaaaacctaccgatcaacgtttctggtgacttg
gaaaatagatacaactttccaagctctgaacccagagcaaaacatgctgtgaagatcaga
gctgcagacgtccgcatcctgaactggagttcctggagtgaagccactgaatttggctcc
gacgaccgaaaccccagctctgtgcacatttacgtgctcctgatcctgggaacccttgtc
tgtggcctcgtctttggcttcctctttaaaagggtacagcgactgttcccgccagttcca
cagatcaaagacaaactgaatgataaccatgatgtggaagacgagatcatctgggaggaa
ttcaccccagaggaagggaagagctaccgtgaagaggtgttgaccgtgaaggaaattacc
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663347
Entry
104663347         CDS       T03989                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X2
  KO
K04737  interleukin 3 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663347 (IL3RA)
   04151 PI3K-Akt signaling pathway
    104663347 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104663347 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104663347 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104663347 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663347 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104663347 (IL3RA)
   04090 CD molecules [BR:rro04090]
    104663347 (IL3RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104663347 (IL3RA)
CD molecules [BR:rro04090]
 Proteins
  104663347 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Gemini_mov
Other DBs
NCBI-GeneID: 104663347
NCBI-ProteinID: XP_010362785
UniProt: A0A2K6Q0W7
LinkDB
Position
22
AA seq 378 aa
MVLLWLTLLLVATPCLLQTKEDRNPPIKNLRMKQKTQQLMWDLNRNVTDVECIKDSDDFM
PAMNNSYCQFGAISVCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFL
SCSWAVGPAAPADVQYDLYLNNLNSHEQHKCLHYNTDARGTRIGCRFDDIARLSSGSQRS
HILVRGRSAAFSIPCTDQFVVFSQIERLTPPHMTAECNKTHSFMQWKMRSHFNRKFRYEL
QIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDPEEGAS
SPAWRTSLPIALGTLLAVLCVFLICRRYLVMQRLFPRIPHMKDPIGDSFQDDKLVIWEAG
KAGLEECLVSEVQVVEKT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtcctcctttggcttacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatcgaaacccaccaatcaagaacctaaggatgaaacaaaagactcagcagctgatg
tgggacctgaacagaaacgtgactgacgtggagtgtatcaaagactccgacgactttatg
ccggccatgaacaatagctattgccagtttggagccatttccgtatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacgcctcgggcaggcgcggagaatctgacctgctgggttcatgatgtggatttcttg
agctgcagctgggcggtaggcccggcagcccccgctgacgtccagtacgacctgtacttg
aacaatctcaacagccacgaacagcacaagtgtcttcactacaacacggatgctcgggga
acacggatcgggtgtcgtttcgatgacatcgctcgactctccagcggttctcaacgttcc
cacatcctggtgaggggcaggagcgcagccttcagtatcccctgcaccgatcagtttgtc
gtcttttcacagatcgagagattaactccaccccacatgactgcagagtgtaataagaca
cattccttcatgcagtggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatccaaaagagaatgcagcctgtaagaacagaacaggtcagagacacaacctccttc
cagctacccaatcctggaacatacacagtgcaaataagagcccgggaaacagtgtatgaa
ttcttgagtgcctggagcaccccccagcgcttcgagtgcgacccggaggagggcgcgagc
tcgcctgcctggcggacgtcgctgccgatcgcgctggggacgctgctggccgtgctctgt
gtcttcctcatctgcagaaggtatctggtgatgcagagactatttccccgcatcccacac
atgaaagaccccatcggtgacagcttccaagacgacaagctggtgatctgggaggcgggc
aaagccggcctggaggagtgtctggtatctgaagtacaggtggtggagaaaacttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663493
Entry
104663493         CDS       T03989                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04066  HIF-1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04659  Th17 cell differentiation
rro04932  Non-alcoholic fatty liver disease
rro05163  Human cytomegalovirus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663493 (IL6R)
   04066 HIF-1 signaling pathway
    104663493 (IL6R)
   04151 PI3K-Akt signaling pathway
    104663493 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104663493 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104663493 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104663493 (IL6R)
   04659 Th17 cell differentiation
    104663493 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663493 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104663493 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104663493 (IL6R)
   05163 Human cytomegalovirus infection
    104663493 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104663493 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104663493 (IL6R)
   04090 CD molecules [BR:rro04090]
    104663493 (IL6R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104663493 (IL6R)
CD molecules [BR:rro04090]
 Proteins
  104663493 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 Ig_5
Other DBs
NCBI-GeneID: 104663493
NCBI-ProteinID: XP_030793063
LinkDB
Position
8
AA seq 508 aa
MGDCPRRLSQPARPPPRPCRPVPTSLSASAGPWSGSRGGSMLAVRCALLAALLAAPGVAL
APGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAAGSHLSRWAGVGRR
LLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP
SPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS
KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAE
RSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRS
PPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLL
CIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSD
NTSSHNRPDARDPQSPYDISNTDYFFPR
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggggattgcccccggagactgagccagcctgcccgcccaccgccccgcccctgccgc
ccggttcccaccagcctgtccgcctctgcgggaccatggagcggtagccgaggaggaagc
atgctggccgtccgctgcgcgctgctggctgccctgctggccgcgccgggggtggcgctg
gccccagggggctgccctgcgcaggaggtggcgagaggtgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccagggggagagccggaagacaatgccactgttcactgg
gttctcaggaagccagctgcaggctcccacctcagcagatgggctggcgtgggaaggagg
ctgctgctgaggtcggtgcagctccatgactctggaaactattcatgctaccgggccggc
cgcccggctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaacgttgtttgtgagtggggtcctcggagcacccca
tctccgacgaccaaggctgtgctgttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcccaggagtcccagaagttctcctgccagttggcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgtcgccagtagtgtcgggagc
aagttcagcaaaactcagacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcacggccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctatagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacgtggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagtttgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacgccttggacagaatccaggagt
cctccagctgagaacgaggtgtccacccccacgcaggcacctactactaataaagacgac
gataatattctctccagagattcagcaaatgcgacaagcctcccagtgcaagattcttct
tcggtaccactgcccacattcctggttgctggagggagcctggccttcggaacgctcctg
tgcattgccattgttctgaggttcaagaagacatggaagctgcgggccctgaaggaaggc
aagacaagcatgcacccgccatattctttggggcagctggtcccagagaggccgcgaccc
accccagtgcttgttcctctcatctccccaccagtgtcccccagcagcctggggtctgac
aacacctcgagccacaaccgaccagatgccagggacccacagagcccttatgacatcagc
aatacagactacttcttccccagatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663558
Entry
104663558         CDS       T03989                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663558 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104663558 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104663558 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104663558 (IL20RB)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104663558 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 104663558
NCBI-ProteinID: XP_010363116
UniProt: A0A2K6RMJ2
LinkDB
Position
1
AA seq 311 aa
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIVP
GETVYYSVEYQGEYESLYASHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
TSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELDDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcagactttcacaatggttctagaagaaatctggacaagtcttttcatgtggtttttc
tacgcattgattccatgtttgctcacagatgaagtggccattctgcctgcccctcagaac
ctctctgtactctcaaccaacatgaagcatctcttgatgtggagcccagtgatcgtgcct
ggagaaacagtgtactattctgtcgaataccagggggagtatgagagcctgtatgcgagc
cacatctggatccccagcagctggtgctcactcactgaaggtcctgagtgtgatgttact
gatgacatcacggccactgtgccatacaacctccgtgtcagggccacactgggctcacag
acctcagcctggagcatcctgaagcatccctttaatagaaactcaaccatccttacccca
cctgggatggagatcaccaaagatggcttccacctggttattgagctggatgacctgggg
ccccagtttgagttccttgtggcctactggaggagggagcctggtgccgaggaacatgtc
aaaatggtgaggagcgggggtattccagtgcacctagaaaccatggagccaggggctgca
tactgtgtgaaggcccagacattcgtgaaggccattgggaggtacagtgccttcagccag
acagaatgtgtggaggtgcaaggagaggccattcccctggtactggccctgtttgccttt
gttggcttcatgctgatccttgtggtcgtgccactgttcgtctggaaaatgggccggctg
ctccagtactcctgttgccccgtggtggtcctcccagacaccttgaaaataaccaattca
ccccagaagttaatcagctgcagaagggaggaggtggatgcctgtgccacagctgtgatg
tctcctgaggaactcctcagggcctggatctcatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664105
Entry
104664105         CDS       T03989                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664105 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664105 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664105 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104664105 (IL13RA1)
   04090 CD molecules [BR:rro04090]
    104664105 (IL13RA1)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104664105 (IL13RA1)
CD molecules [BR:rro04090]
 Proteins
  104664105 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2 LIFR_N
Other DBs
NCBI-GeneID: 104664105
NCBI-ProteinID: XP_010363838
UniProt: A0A2K6PPA4
LinkDB
Position
7
AA seq 505 aa
MSSLGSPRSHRSCQSRRRTAPPRPAALASSGYLRPVGGAALPVCSGPQPPGRRSREEEEG
AKEAGTAEAPARLGSQARGCMERPARLCGLWALLLCAGGGAGGAAPTETQPPVTNLSVSV
ENLCTVIWTWNPPEGASPNCSLWYFSHFGDKQDKKLAPETRRSKEVPLNEKICLQVGSQC
STNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYY
WHRSLEKIRQCEEIYKEGQYFGCSFDLTKVKDSSFEQHSVQIMVKDYAGKIKPSFNIVPL
TSRVKPDPPHIKNLSFHNGDLHVQWENPQNFISRCLFYEVEVNNSQTETHNVFSVQEAKC
QNPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNS
TLYIIMLLIVPVIVAGAIIVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKY
DIYEKQTKEETDSVVLIENLKKASQ
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtcgagccttgggagccctaggagccataggagctgccagagccgccggcgcaccgcc
ccgcctcgtcctgctgctctcgccagctcaggttacctgaggccggtgggcggggcggcc
cttcccgtctgctccggcccccagcctccagggcggcggagccgggaagaggaagaggga
gcgaaggaggcggggactgccgaggctccagcccggctgggctcccaggcgagaggctgc
atggagcggccggcgcggctctgcgggctatgggcgctgctgctctgcgccggcggcggg
gccgggggcgccgcgcccacggaaactcaaccacctgtgacaaatttgagtgtctctgtt
gaaaacctctgcacagtaatatggacatggaatccacccgagggagccagcccaaattgt
agtctatggtattttagtcattttggcgacaaacaagataagaaactagctccagaaact
cgtcgttcaaaagaagtgcccctgaatgagaagatttgtctgcaagtggggtcccagtgt
agcaccaatgaaagtgagaagcctagcattttggttgaaaaatgcatctcgccccctgaa
ggtgatcctgagtctgctgtgactgagcttcaatgcatttggcacaacctgagctacatg
aagtgttcttggctccctggaaggaataccagccccgacactaactatactctctactat
tggcacagaagcctggaaaaaattcgtcaatgtgaagagatctataaagaaggccagtac
tttggttgttcctttgatctgaccaaagtgaaggattccagttttgaacaacacagtgtc
caaataatggtcaaggattatgcaggaaaaattaaaccatccttcaatatagtgccttta
acttcccgtgtgaaacctgatcctccacatattaaaaacctctccttccacaatggtgac
ctacatgtacaatgggagaatccacagaattttattagcagatgcttattttatgaagta
gaagtcaataacagccaaaccgagacacataatgttttctccgtccaagaggctaaatgt
cagaatccagaatttgagagaaatgtggagaatacatcttgtttcatggtccctggtgtt
cttcctgataccttgaacacagtcagaataagagtcaaaacaaataagttatgctatgag
gatgacaaactctggagtaattggagccaagaaatgagtataggtaagaagcgcaattcc
acactctacataatcatgttactcattgttccagtcatcgtcgcaggtgcaatcatagta
cttctgctttacctaaaaaggctcaagatcattatattccctccaattcctgatcctggc
aagatttttaaagaaatgtttggagaccagaatgatgatactctgcactggaagaagtac
gacatctatgagaagcaaaccaaggaggaaaccgactctgtagtgctgatagaaaacctg
aagaaagcctctcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664347
Entry
104664347         CDS       T03989                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor isoform X2
  KO
K05062  leptin receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04152  AMPK signaling pathway
rro04630  JAK-STAT signaling pathway
rro04920  Adipocytokine signaling pathway
rro04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664347 (LEPR)
   04152 AMPK signaling pathway
    104664347 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104664347 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    104664347 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104664347 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104664347 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104664347 (LEPR)
   04090 CD molecules [BR:rro04090]
    104664347 (LEPR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  Prolactin receptor family
   104664347 (LEPR)
CD molecules [BR:rro04090]
 Proteins
  104664347 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 104664347
NCBI-ProteinID: XP_010364137
LinkDB
Position
12
AA seq 925 aa
MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSAYDYFLLPAGLSKNTSNL
NGHYETAVEFNSSDTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSSVFQQ
IGVNWNIQCWLKGDLKLFICYMESLFKNPFKNYNHKVHLLYVLPEVSEDSPLVPQKGSFQ
MVHCNCSVHECCECLVPVPTAKLSNTLLMCLKITSGGIIFQSPLMSVQPINMVKPDPPLG
LRMEITVDGNLKISWSSPPLVPFPLQYEVKYSENSTTVIREADKIISATSLLVDSILPGS
SYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKIVS
SKKIVWWMNLAEKIPQSQYDVVSDHVSQVTFFNLNETKPRGKFTYDAVYCCNEHECHHRY
AELYVIDVNINISCETDGYLTKMTCRWSTNTIQSLAGSTLQLRYRRRSLYCSDIPSIHPI
SKPKDCYLQRDGFYECVFQPIFLLSGYTMWIRINHPLGSLDSPPTCVLPDSVVKPLPPSS
VKAEITKNIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYDVYDAKSKSVSLPVPD
FCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNVTL
LWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSIGA
SVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVILSWILSPSDYKLMYFIIEWKNLNEDGE
IKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDTEKHQNDAGL
YVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKVRGFVMLPRLV
LNSQAEVIHPPRPPKMLELQRTDIL
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggttttgttacattgggaatttatttatgtgataact
gcatttaacttgtcatatccaattactccttggagatttaagttatcttgcatgccacca
aattcagcctatgactacttccttttgcctgctggactctcaaagaatacttcaaatttg
aatggacattatgagacagctgttgagtttaattcaagtgatactcacttttctaactta
tccaaaacaactttccactgttgctttcggagtgagcaagatagaaactgctccttatgt
gcagacaacattgaaggaaagacatttgtttcaacagtaaattcttcagtttttcaacaa
ataggtgtaaactggaacatacagtgctggctaaaaggagacttgaaattattcatctgt
tatatggagtcattatttaagaatccattcaagaattacaaccataaggtccatctttta
tatgttctgccggaagtgtcagaagattcacctctggttccccaaaaaggcagttttcag
atggttcattgcaattgcagtgttcatgaatgttgtgaatgtcttgtgcctgtgccaaca
gccaaactcagcaacactctccttatgtgtttgaaaatcacatctggtggaataattttc
cagtcacctctaatgtcagttcagcccataaatatggtgaagcctgatccaccattaggt
ttgcgtatggaaatcacagttgatggcaatttaaagatttcttggtccagcccaccattg
gtaccatttccacttcaatatgaagtgaaatattcagagaattctacaacagttatcaga
gaagctgacaagatcatctcagctacatccctgctggtagacagtatacttcctgggtct
tcatatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagtgactgg
agtactcctcatgtctttaccacacaagatgtcatatactttccacctaaaattctgaca
agtgttggatctaatgtttcttttcactgcatctataagaatgaaaacaagattgtttcc
tcaaaaaagattgtttggtggatgaatttagctgagaaaatccctcaaagccagtatgat
gttgtgagtgatcatgttagccaagttacttttttcaatctgaatgaaaccaaacctcga
ggaaagtttacctatgatgcagtgtactgctgcaatgaacatgaatgccatcatcgctat
gctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatgggtactta
actaaaatgacttgcagatggtcaaccaatacaatccagtcacttgcgggaagcactttg
caattgaggtatcgtaggaggagcctttactgttctgatattccatctattcatcccata
tctaagcctaaagattgctatttgcagagggatggtttttatgaatgcgttttccagcca
atctttctattatctggctatacaatgtggattaggatcaatcaccctctaggttcactt
gactctccaccaacatgtgtccttcctgattctgtggtgaagccactgcctccatccagt
gtgaaagcagaaattactaaaaacattggattattgaaaatatcttgggaaaagccagtc
tttccagagaataaccttcaattccagattcgctatggtttgagtggaaaagaagtacaa
tggaagatgtatgacgtttatgatgcaaaatcaaaatctgtcagtctcccagttccagac
ttctgtgcagtttatgctgttcaggtgcgctgtaagaggttagatggattgggatattgg
agtaattggagcaatccagcctacacagttgtcatggatataaaagttcctatgagagga
cctgagttttggagaataattaatggagatactatgaaaaaggagaaaaatgtgacttta
ctttggaagcccctgatgaaaaatgactcattgtgcagtgttcagagatatgtgataaac
catcatacttcctgcaatggaacatggtcagaagatgtgggaaatcacactaaattcact
ttcctgtggacagagcaagcacacactgttacagttctggccatcaattcaattggtgct
tctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatcgtgcag
tcactcagtgcttatcctttaaacagcagttgtgtgattctttcctggatactatcaccc
agtgattacaagctaatgtattttattattgagtggaaaaatcttaatgaagatggagaa
ataaaatggcttagaatctcttcatctgttaagaagtattatatccatgatcattttatc
cccattgagaagtaccagttcagtctttacccaatatttatggaaggagtgggaaaacca
aagataattaatagtttcactcaagatgatactgaaaaacaccagaatgatgcaggttta
tatgtgattgtgccagtaattatttcctcttccatcttattgcttggaacattattaata
tcgcaccaaagaatgaaaaagctgttttgggaagatgttccaaaccccaagaattgttcc
tgggcgcaaggacttaattttcagaaggtacggggttttgtcatgttgcccaggctggtc
ttgaactcccaggctgaagtgatccacccacctcggcctcccaaaatgctggaattacag
agaacggacattctttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664843
Entry
104664843         CDS       T03989                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X4
  KO
K05074  interleukin 15 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04672  Intestinal immune network for IgA production
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664843 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664843 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    104664843 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664843 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104664843 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104664843 (IL15RA)
   04090 CD molecules [BR:rro04090]
    104664843 (IL15RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104664843 (IL15RA)
CD molecules [BR:rro04090]
 Proteins
  104664843 (IL15RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 104664843
NCBI-ProteinID: XP_010364812
UniProt: A0A2K6P311
LinkDB
Position
11
AA seq 238 aa
MAPRRARGCRTLRLPALLLLLLLRPPATRGITCPPPVSVEHADIRVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNIAHWTTPSLKCIRDPLLARQRPAPPFTVTTAGVTPQPE
SLSSSGKEPTASSPSSNTTAATTAAIVPSSRLVPSTSPSTGTTEIGSHESSHGPSQTTAK
TWELTASASHQPPGVYPQGHSEHHCGYLHIHRPAVWTERCVSPGMLHQVKANSPAGQH
NT seq 717 nt   +upstreamnt  +downstreamnt
atggccccgcggcgggcgcgcggctgccggaccctccgcctcccggcgctgctgctgctg
ctgctgctccggccgccagcgacgcggggcatcacgtgccctcccccagtgtccgtggaa
cacgcagacatccgggtcaagagctacagcttgtactccagggagcggtacatttgtaac
tctggtttcaagcgtaaagccggcacgtccagcctgactgagtgcgtgctgaacaaggcc
acgaacatcgcccactggacaacccccagtctcaaatgcattagagaccctctcctggct
cgccaaaggccagcgcctcccttcacagtaacgacggcaggggtgaccccacagccagag
agcctctcctcttctggaaaagagcccacagcttcatctcccagctcaaacaccacagcg
gccacaacagcagccattgtcccgagctcccggctggtgccctccacatcaccttccaca
ggaaccacagagataggcagtcatgagtcctcccacggcccctctcagacgacagccaag
acctgggaactcacggcatccgcctcccaccagccgccaggtgtgtatccacagggccac
agcgaacaccactgtggctatctccacatccaccgtcctgctgtgtggactgagcgctgt
gtctctcctggcatgctacatcaagtcaaggcaaactcccccgccggccagcattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664846
Entry
104664846         CDS       T03989                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X4
  KO
K05068  interleukin 2 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664846 (IL2RA)
   04151 PI3K-Akt signaling pathway
    104664846 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664846 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104664846 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104664846 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104664846 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    104664846 (IL2RA)
   04659 Th17 cell differentiation
    104664846 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664846 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104664846 (IL2RA)
   05162 Measles
    104664846 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104664846 (IL2RA)
   04090 CD molecules [BR:rro04090]
    104664846 (IL2RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104664846 (IL2RA)
CD molecules [BR:rro04090]
 Proteins
  104664846 (IL2RA)
SSDB
Motif
Pfam: Sushi TMEM100
Other DBs
NCBI-GeneID: 104664846
NCBI-ProteinID: XP_010364817
LinkDB
Position
11
AA seq 278 aa
MDPYLLMWGLLTVITVPGCQAVFFCFAELCDYDPPKITHATFKAVAYKEGTMLNCECKRG
FRRIKSGSPYMLCTGNSGHSSWDNQCQCTSSAARNATKQVTPQPEEQKERKTTEMQSQMQ
LADQASLPGHCREPPLWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGK
TRWTQPQLICTSETEPSQFPGEEEPQASPDGLAESETSRLITTTDFRIQTEVAATMETFI
FTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKNRRTI
NT seq 837 nt   +upstreamnt  +downstreamnt
atggatccatacctgctcatgtggggactgctcacggtcatcacggtgcctggctgccag
gcagtcttcttttgctttgcagagctctgtgactatgacccgccaaaaatcacacacgcc
acgttcaaagccgtggcctacaaggaaggaaccatgttgaactgtgaatgcaagagaggt
ttccgcagaataaaaagcgggtcaccctatatgctctgtacaggaaactctggccactca
tcctgggacaaccaatgtcaatgcacaagctctgctgctcggaacgcaacaaaacaagtg
acacctcaacctgaagaacagaaagaaagaaaaaccacagaaatgcaaagtcaaatgcag
ctggcggaccaagcaagccttccaggtcactgcagggaacctccactatgggaaaatgaa
gccacagaaagaatttatcatttcgtggtggggcagacggtttactaccagtgcgtccag
ggatacagggctctacacagaggtcctgctgagagcgtctgcaaaatgacccacgggaag
acaaggtggacccagccccagctcatatgcacaagtgaaacggagcccagtcagtttcca
ggtgaagaggagcctcaggcaagccccgacggccttgctgagagtgagacttcccgcctc
atcacaacaacagattttcgaatacagacagaagtggctgcaaccatggaaacgttcata
tttacaacagagtaccaggtagcagtggccggctgtgttttcctgctgatcagcgtcctc
ctcctgagtgggctcacctggcagcggagacagaggaagaatagaagaacaatctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665564
Entry
104665564         CDS       T03989                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665564 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104665564 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104665564 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104665564 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104665564 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104665564 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104665564 (IL10RA)
   04090 CD molecules [BR:rro04090]
    104665564 (IL10RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104665564 (IL10RA)
CD molecules [BR:rro04090]
 Proteins
  104665564 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind DUF4501
Other DBs
NCBI-GeneID: 104665564
NCBI-ProteinID: XP_010365728
UniProt: A0A2K6PZP5
LinkDB
Position
15
AA seq 578 aa
MLPRLVVLLAAFLSRRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGVEPWNSISNCSQALSYDLTAVTLDLYRSNGYRARVRAVDGSRHSNWTVTNTRFSV
DEVTLTVGSVKLEIHNGFILGKIQPPRPKMAPENDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVTSRTNKGMWSKEECVSLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPRVLLFRKPNAFIFISQRPSPEIQDTIHPLDEEA
FLKVSPELRNSDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPELGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSDSKGQDDSGIGLVQNSEGQAGDTQGGS
ALGHDSPPEPEVPAEQDPTAVVFRGYLRQTRCAEEKATKTGCLEEELPLTGGLGPKFRGC
LDDKAGLHPPALAKGYLKQDPLEMTLASSGAPTEQWNQPTEEWSLLALSSCSDLGTSDWS
FAHDLAPLGCVVAPGGLLGSFNSDLVTLPLISSLHSSE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgctcccgcgcctcgtagtgctgctggcggcgttcctcagtcgccgccttggctcagac
gctcatgggacagagctacccagcccgccatctgtgtggtttgaagcagaatttttccac
cacatcctccactggacacccatcccaaatcagtctgaaagtacctgctatgaagtggcg
ctcctgaggtatggagtagagccctggaactccatctccaactgtagccaggccctgtcc
tatgaccttaccgcagtgaccttggacctgtaccgcagcaatggctaccgggccagagtg
cgtgctgtggatggcagccggcactccaactggaccgtcaccaacacccgcttctctgtg
gatgaagtgactctgacagttggcagtgtgaagctagagatccacaatggcttcatcctc
gggaagattcagccccccaggcccaagatggcccctgaaaatgacacatatgaaagcatc
ttcagtcacttccgagagtatgagattgccattcgcaaggtgccgggaaactttacgttc
acacacaagaaagtaaaacatgaaaacttcagcctcctaacctctggagaagtgggagag
ttctgtgtccaggtgaaaccatctgtcacctcccgaactaacaaggggatgtggtctaaa
gaggagtgcgtctccctcaccaggcagtatttcaccgtgaccaacgtcatcatcttcttt
gcctttgtcctgctgctctccggagccctggcctactgcctggccctccagctgtatgtg
cggcgccgaaagaagctgcccagggtcctgctcttcaggaagcccaacgccttcatcttc
atcagccagcgtccctccccagaaatccaagacaccatccacccgcttgatgaggaggcc
ttcctgaaggtgtcaccagagctgaggaactcggacctgcatggcagcacggacagtggc
tttggcagtaccaagccatccctgcagactgaagagccccagttcctcctccctgaccct
cacccccaggctgacagaacgctgggaaatggagagccccctgagctgggcgacagctgc
agtagtggtagcagcaatagcacagacagcgggatctgcctgcaggagcccagcctgagc
cccagcactgggcccacctgggagcagcaggtggggagcgacagcaagggccaggatgac
agtggcattggcctagttcaaaactctgagggccaggctggggacacacagggtggctca
gccttgggccacgacagtcccccagagcctgaggtgcctgcggaacaagacccaactgct
gtggtattccggggctacctgaggcagaccagatgcgctgaggagaaggcaaccaagaca
ggctgcctggaggaagaattgcccctgacaggtggccttgggcccaaattcaggggatgc
ctggatgacaaggcaggcttgcatccaccagccctggccaagggctatttgaaacaggat
cccctagaaatgactctggcttcctcgggggccccaactgaacagtggaaccagcccact
gaggaatggtcactcctggccttgagcagctgcagtgacctgggaacatctgactggagc
tttgcccatgaccttgcccctctaggctgtgtggtagccccaggtggtctcctgggcagc
tttaactcagacctggttaccctgcccctcatctctagcctgcactcaagtgagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665638
Entry
104665638         CDS       T03989                                 

Gene name
IL4R
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665638 (IL4R)
   04151 PI3K-Akt signaling pathway
    104665638 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104665638 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104665638 (IL4R)
   04658 Th1 and Th2 cell differentiation
    104665638 (IL4R)
   04659 Th17 cell differentiation
    104665638 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665638 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104665638 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104665638 (IL4R)
   04090 CD molecules [BR:rro04090]
    104665638 (IL4R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104665638 (IL4R)
CD molecules [BR:rro04090]
 Proteins
  104665638 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 104665638
NCBI-ProteinID: XP_030780469
LinkDB
Position
20
AA seq 825 aa
MGWLCSGLLFPVSCLVLLQVASSGSMKVLQEPTCVSDYMSISTCEWKMGGPTNCSAKLRL
LYQLVFQSSETHTCVPENNGSVGCVCHLLMDDVVSMDNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTDVSDTVLLTWSNPYPPDNYLYNDLTYAVNIWSENDPADFRIYNVTYL
KPTLRIPASTLKSGISYRARVRAWAQHYNTTWSEWSPSTKWYNSYREPFEQRLLLGVSAS
CIVILAFCLLCYVSITKIKKEWWDQIPNPARSHLVAIIIQDAQESQWERRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAVKDLPFQGSGKSSWCPVEISRTVLWPENISVVR
CVELFEAPGECEEEEGVEEDKGSFCASPESNRDDFQEGREGIVARLTESLFLDLLGGENG
GFCQQDMGESCLLPTLGSTSAHMPWDEFPSAGPKEVPPWGKEQPLHQEPSPPARPTQSPD
NLTFTEMPLVVSGNPAYRSFSNSLSQSPHPRELGPDPLLARHLEEVDPEMPCAPQLSEPT
TVGPPEPETWEQILRRNVLRHGAAAAPASAPTSGYREFVHAVQQGGIQASAVAGLGPPGE
AGYKAFSSLLASSAVSPGECGFGASSGEDGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPHSPQSSHLPSSSPEHLGLEPGEKVEDMQKPPLPLEQATDPLGDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQAPVVASPCCGCCCGDRSSPPTPPLRAPDPSLGGVPLEASLCPASL
APSGISEKSKSSLSFHPAPGSAQSSSQTPQIVNFVSVGPTCMRVS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtc
gcaagctctgggagcatgaaggtcctgcaggagcccacctgcgtctccgactacatgagc
atctctacgtgtgaatggaagatgggtggtcccaccaactgcagcgccaagctccgtctg
ttgtaccagctggtttttcagtcctccgaaacccacacgtgtgtccccgagaacaacggc
agtgtggggtgcgtgtgccacctgctcatggatgatgtggtcagtatggacaactatacg
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctcacggttcacaccgatgtctccgacactgtgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatgatctcacctacgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
aaacccaccctccgcatcccagccagcaccctgaagtctggaatttcctacagggcacgg
gtgagggcctgggctcagcactataacaccacctggagtgagtggagccccagcaccaag
tggtacaactcctacagagagcccttcgagcagcgcctcctgctgggtgtcagcgcctcc
tgcattgtcatcctggccttctgcctgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggaccagattcccaacccagcccgcagccacctcgtggctataataatccag
gatgctcaggagtcacagtgggagaggcgatcccgaggccaggaaccagccaagtgccca
cactggaagaattgtctcaccaagctcttgccctgttttctcgagcacaacatgaaaagg
gatgaggatccccacaaggctgtcaaagatctgcctttccagggctctggaaaatcatca
tggtgcccggtggagatcagcaggacagtcctctggccagagaacatcagcgtggtgcgg
tgcgtggagttgtttgaggctccaggggagtgtgaggaggaggagggggtagaggaagac
aaagggagcttctgtgcatcacctgagagcaacagggatgacttccaggagggaagggag
ggtattgtggcccggctgacagagagcctgttcctggacctgctcggaggggagaatggg
ggcttttgccagcaggacatgggggagtcgtgccttcttccaactttgggaagcacgagt
gctcacatgccctgggatgagttcccaagtgcagggcccaaggaggtgcctccctggggc
aaggagcagcctctccaccaggagccgagtcctcctgcccgcccaacgcagagcccagac
aacctgactttcacagagatgcccctcgttgtctcaggcaaccctgcttaccgcagcttc
agcaactccctgagccagtccccgcatcccagagagctgggtccagacccgctgctggcc
agacacctggaggaagtggaccctgagatgccctgtgccccccagctctctgagccaacc
actgtgggcccacctgagccagaaacctgggagcagatcctccgtcggaatgtcctccgg
cacggggcggctgcagcccccgcctcggcccccaccagtggctatagggagtttgtacat
gcggtgcagcagggtggcatccaggccagtgcggtggcgggcttgggtcccccgggagag
gctgggtacaaggccttctcgagcctgcttgccagcagtgccgtgtccccgggggaatgt
ggatttggggctagcagtggggaagacgggtataagcctttccaagacctcattcctggc
tgccccggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcacagcccgcagagctcacacctcccaagcagctccccagagcacctgggtctg
gaaccaggggaaaaagtagaggacatgcagaagcccccactccccctggagcaggccaca
gacccccttggggacagcctgggcagcggcatcgtctactcagccctcacctgccacctg
tgcggccacctgaagcagtgtcatggccaggaggatggtggccaggcccctgtcgtggct
agtccctgctgtggctgctgctgtggagacaggtcctcgccccctacaccccccctgagg
gccccagacccctctctaggtggggttccactggaggctagcctctgtccggcctccctg
gcaccctcgggcatctccgagaagagtaaatcctcattgtccttccatcctgcccctggc
agtgctcagagctccagccagactccccagatcgtgaactttgtctccgtgggtcccaca
tgcatgagggtctcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665752
Entry
104665752         CDS       T03989                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665752 (OSMR)
   04151 PI3K-Akt signaling pathway
    104665752 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104665752 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104665752 (OSMR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104665752 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 104665752
NCBI-ProteinID: XP_010365959
LinkDB
Position
3
AA seq 978 aa
MALFVVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSIHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVVWVGNYSTTVKWNQVLHWSWESELPLECATHFVRMKSVMDD
ASFPEPNFWSNWSSWEEVSVQDSLGRGILFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNRGTNIYCEASQGNVSKGIEGIVLFVSKVLEEP
KDFSCETQDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQQYDVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWS
GQNFTTLEAAPSEAPDVWRSVNSEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPS
RSELRSIPAPANSTKLILDRCSYQICVTANNSVGASPASIIVISVDPENKEVEEERIAGT
DGRFSLSWKPQPGDIIGYVVDWCDHPQDVLQWKNVGPNTTSTVISTDAFRPGVRYDFRIY
GLSTKRIACLLEKKTGYSQELAPSDNPHVLVDMLTSHSFTLSWKDYSTESQPGFIQGYHV
YLKSKARQCHPRFQKAVLSDGSECCKYKIDNPEEKALIVDNLKPESSYEFFVTPFTSAGE
GPNATFTKVTTPDEHSSMLIHILLPMVFCVLLIMIVCYLKSQWIKETCYPDIPDPYKSSI
LSLIKFKENPHLTIMNVSDCIPDAIEVVSKPEGTKIQILGTRKSLTETELTKPNYLYLLP
TEKNHSGPGPCICFENFTYNQAASDSGFCGHVPVSPKAPPSMLGLMTSPENVLKALEKNY
MNSLGEVPAGETSLNYVSQLASPMSGDKDSLPTNPVEPPHCSEYKMQMAVPLRLALPRPT
ENSSLSSITLLDPGEHYR
NT seq 2937 nt   +upstreamnt  +downstreamnt
atggctctatttgtagtctttcagacaacattcttcttaacattgctgtccttgaggact
taccagagtgaagtcttggctgaacgtttaccattgactcctgtgtcacttaaagtttcc
accaattctatacatcagagtttgcatttacaatggactgtccacaaccttccttatcat
caggaattgaaaatggtatttcagatccagatcagtaggattgaaacatccaatgttgtc
tgggtggggaattacagcaccactgtgaagtggaaccaggttctgcattggagctgggaa
tcagaactccctttggaatgtgccacacactttgtaagaatgaagagtgtgatggatgat
gccagtttccctgagccaaatttctggagcaactggagttcctgggaggaagtcagtgta
caagattctcttggaaggggtatattgttcgttttccctaaagataagctggtggaagaa
ggctccaatgttaccatttgttatgtttctaggaacattcaaaataatgtatcctgttat
ttggaagggaaacagattcatggagaacaacttgatccacatgtaactgcattcaacttg
aatagtgtgcctttcattaggaatagagggacaaatatctattgtgaggcgagtcaagga
aatgtcagtaaaggcatagaaggcatcgttctctttgtctcaaaagtacttgaggagccc
aaggacttttcttgtgaaacccaggacttcaagactttgcactgtacttgggatcctggg
acggacactgccttggggtggtctaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaagaaactttgtacacacaaaaactggtgtaattggcaaataactcaa
gactcacaagaaacgtataacttcacactcatagctgaaaattacttaaggaagagaagt
gtcaatatcctttttaacctgactcatcgagtttatttaatgaatccttttagtgtcaac
tttgaaaatgtaaatgccacaaacgccatcatgacctggaaggtgcactccatgaggaat
aatttcacatatttgtgtcagattgaactccatggtgaaggaaaaatgatgcaacagtac
gatgtttctatcaaggtgaacggtgagtacttcttaagtgaactggaacctgccacagag
tatatggcccgagtacgctgtgctgatgccagccacttctggaaatggagtgaatggagt
ggtcagaacttcaccacacttgaagctgctccttcagaggcccctgatgtctggagaagt
gtgaactcagagccaggaaatcatactgtgaccttattctggaagccattatcaaaactg
catgccaatggaaagatcctgttctataatgtagttgtagaaaacctagacaaaccgtcc
aggtcagagctccgttccattccggcaccagccaacagcacaaaactaatcctcgacagg
tgttcctaccaaatctgcgtcacagccaacaacagtgtgggcgcttctcctgcttctata
atagtcatctctgtggaccctgaaaacaaagaggttgaggaagaaagaattgcaggcaca
gatggtagattctctctgtcttggaaaccccagcctggagatattataggctatgttgtg
gactggtgtgaccatccccaggatgtgctccagtggaagaatgtaggtcccaataccaca
agcacagtcattagtacagatgcttttaggccaggagttcgatatgacttcagaatctat
gggttatctacaaaaaggattgcttgtttattagagaaaaaaacaggatactctcaggaa
cttgctccttcagacaaccctcacgtgctggtagatatgttgacatcccactccttcact
ctgagttggaaagattactctactgaatctcagcctggttttatacaagggtaccatgtc
tatctgaaatccaaggcaaggcagtgccacccacgatttcaaaaggcagttctttcagat
ggttcagaatgttgcaaatacaaaattgacaacccagaagaaaaggcattgattgtggac
aacctaaagccagaatcctcctatgagtttttcgtcactccattcactagtgctggcgag
ggccccaatgctacgttcacgaaggtcacgactccggatgaacactcctcgatgttgatt
catatcctactgcccatggttttctgcgtcttgctcatcatgatcgtgtgctacttgaaa
agtcagtggatcaaggagacgtgttatcctgacatccctgacccttacaagagcagcatc
ctgtcgttaataaaattcaaggagaaccctcacctaacaataatgaatgtcagtgactgt
atcccagatgctattgaagttgtaagcaagccagaagggacaaagatacagatcctaggc
actaggaagtcactcacagaaactgagttgactaagcctaactacctttatctccttcca
acagaaaagaatcactctggccctggcccctgcatctgttttgagaactttacctataac
caggcagcttctgactctggcttttgtggccatgttccagtatcccccaaagccccacca
agtatgctgggactaatgacctcacctgaaaatgtactaaaggcactagaaaaaaactac
atgaactccctgggagaagtcccagctggagaaacaagtttgaattatgtgtcccagttg
gcttcacccatgtctggagacaaggacagtctcccaacaaacccagtggagccaccacac
tgttcagagtataaaatgcaaatggcagtccccctgcgtcttgccctgcctcgcccgacc
gagaatagcagcctttcctcaattacccttttagatccaggtgaacactaccgctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665755
Entry
104665755         CDS       T03989                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665755 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104665755 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104665755 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104665755 (LIFR)
   04090 CD molecules [BR:rro04090]
    104665755 (LIFR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104665755 (LIFR)
CD molecules [BR:rro04090]
 Proteins
  104665755 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind TMEM154 DUF3827
Other DBs
NCBI-GeneID: 104665755
NCBI-ProteinID: XP_010365963
UniProt: A0A2K6NTE1
LinkDB
Position
3
AA seq 1097 aa
MMDIYVCLKRASWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNL
QVWDCYWKAPSGTGRGIDYEVCIENRSHSCYQLEKTNIKIPALSHGDYEITINSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHHSDVIWEIKILRKE
SMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGHKEWSDWSP
VKNISWMPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIRLDGENVAIK
IRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEILCSWNPGRATA
LVGPRATSYTLLESFSGKYVRFKRAEAPTNESYQLFFQMLPNQEIYNFTLNAHNPLGRSE
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCQIEIKKSNSVQEQR
NVTIKGVENSSYLVALDKLNPYTVYTFRIRCSTETFWKWSKWSNKKQHLTTEAIPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIQLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVVK
WCNSSRSEPCLMDWRKVPSNSTETVIESDQFRPGVRYNFFLYGCRNQGYQLLRSMIGYIE
ELAPTVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSGLKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPIAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTMEDIAAEE
DLEKTVGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPES
NGGGWSFTNFFQNKPND
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatggatatttacgtatgtttgaaacgagcatcctggatggtggacaataaaagaatg
aggactgcttcaaatttccagtggctcttatcaacatttattcttctgtatctaatgaat
caagtaaatagccagaaaaagggggctcctcatgatttgaagtgtgtaactaacaatttg
caagtgtgggactgttattggaaagcaccctctggaacaggccgtggtattgattatgaa
gtttgcattgaaaacaggtcccattcttgttatcaactggagaaaacaaatattaaaatt
ccagctctttcacatggtgattatgaaataacaataaattctctacatgattttggaagt
tctacaagtaaattcacactaaatgaacaaaatgtttccttaattccagatactccagag
atcttgaatttgtctgctgatttctcaacctctacattatacctaaagtggaatgacagg
ggttcagtttttccacaccactcagatgttatctgggaaattaaaattctacgtaaagag
agtatggagctcgtaaaattagtgacccacaacacaactctgaatggcaaagatacactt
catcactggagttgggcctcagatatgcccttggagtgtgccattcattttgtggaaatt
agatgctacattgacaatcttcatttttctggtcacaaagagtggagtgactggagccct
gtgaagaacatttcttggatgcctgattctcagactaaggtttttcctcaagataaagtg
atacttgtaggctcagacataacattttgttgtgtaagtcaagaaaaagtgttatcagca
ctgattggccatacaaactgccccttgatccgtcttgacggggaaaatgttgcaatcaag
attcgtaatatttctgtttctgcaagtagtggaacaaatgtggtttttacaaccgaagat
aacatatttggaacggttatttttgctggatatccaccagatactcctcaacaactgaat
tgtgagacacatgatttaaaagaaattctatgtagttggaatccaggaagggcgacagca
ttggtgggcccacgtgctacaagttacactttacttgaaagtttttcaggaaaatatgtt
agatttaaaagagctgaagcaccgacaaatgaaagctatcaattattctttcaaatgctt
cccaatcaagaaatatataattttactttgaatgcccacaatcctctgggtcgatcagaa
tcaacaattttagttaatataactgaaaaagtttatccccatactcctacttcattcaaa
gtgaaggatattaattcaacagctgttaaactttcttggcatttaccaggcaactttgca
aagattaattttttatgtcaaattgaaattaagaaatctaattcagtacaagaacagcgg
aatgtcacaatcaaaggagtagaaaattcaagttatcttgttgctctggacaagttaaat
ccgtacactgtatatacttttcggattcgttgttctactgaaactttctggaaatggagc
aaatggagcaataaaaaacaacatttaaccacagaagccattccttcaaaggggcctgac
acttggagagagtggagttctgatggaaaaaatttaataatctattggaagcctttaccc
attaatgaagctaatggaaaaatactttcctacaatgtatcatgttcatcagatgaggaa
acacagtccctttctgaaatccctgatcctcagcacaaagcagagatacagcttgataag
aatgactacatcatcagtgtggtggctaaaaattctgtgggctcgtcaccaccttccaaa
atagcgagtatggaaattccaaatgatgatctcaaaatagagcaagttgttgggatggga
aagggcattctcctcacctggcattacgaccccaacatgacttgtgactacgtcgttaag
tggtgtaactcgtctcggtcggaaccatgccttatggactggagaaaagtcccctcaaac
agcactgaaactgtaatcgaatctgatcagtttcgaccaggtgtaagatacaattttttc
ctgtatgggtgcagaaatcaaggatatcaattattacgctccatgattggatatatagaa
gaattggctcccactgttgcaccaaattttactgttgaggatacttctgcagattcgata
ttagtaaaatgggaagacattcctgtggaagaacttagaggctttttaagaggatatttg
ttttactttggaaaaggagaaagagacacatcaaagatgagggttttagaatcaggtcgt
tctgacataaaggttaagaatattactgacatatcccagaagacactgaggattgctgac
cttcaaggtaaaacaagttaccacctggtcttgcgagcctatacagatggtggagtgggc
ccagagaagagtatgtacgtggtgacaaaggaaaattctgtgggattaattattgccatt
ctcatcccagtggcagtggctgtcattgttggagtggtgacaagtatcctttgttatcgg
aaacgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaa
gcgttacagtttcaaaagagtgtctgtgagggaagcagtggtcttaaaacattggaaatg
aatccttgtaccccaaataatgttgaggttctcgaaactcgatcagcatttcctaaaata
gaagatacagaaataatttccccaatagctgagcgtcctgaagatcgctctgatgcagag
cctgaaaaccatgtggttgtgtcgtattgtccacccatcattgaggaagaaataccaaac
ccagcagcagatgaagctggagggactgcacaagtcatttacattgatgttcagtcgatg
tatcagcctcaagcaaaaccagaagaagaacaagaaaatgaccctgtaggaggagcaggt
tataaaccacagatgcacctccccattaattctactatggaagatatagctgcagaagag
gacttagagaaaactgtgggttacagacctcaggccaatgtaaatacatggaatttagtg
tctccagactctcctagatccatagacagcaacagtgagattgtctcatttggaagtcca
tgctccattaattcccgacaatttttgattcctcctaaagatgaagactctcctgaatct
aatggaggaggatggtcctttacaaacttttttcagaacaaaccaaacgattaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667785
Entry
104667785         CDS       T03989                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104667785 (GHR)
   04151 PI3K-Akt signaling pathway
    104667785 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104667785 (GHR)
   04060 Cytokine-cytokine receptor interaction
    104667785 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104667785 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104667785 (GHR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  Prolactin receptor family
   104667785 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 104667785
NCBI-ProteinID: XP_030783147
LinkDB
Position
3
AA seq 638 aa
MDLWQLLLTLALAGSSDAFSGSEATAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPPN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMNQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKNEGS
DTDRLLSSDHQKSHSNLGVKDGDSGRTSCYEPDILETDFNANDIHEGTSEVAQPQRLKGE
TDLLCLDQKNQNKSPYHDACPATQQPSVIQAEKNKPQPLPTDGAESTHQAAHIQLSNPSS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHLEMVSLCQENFIMDNAYFCEADA
KKCIPVAPHIKVESHIEPSFNQEDIYITTESLTTTAGRPGTTEHIPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttctct
ggaagtgaggccacagcagctatccttagcagagcatcctggagtctgcaaagtgttaat
ccaggtctaaagacaaactcttctaaggagcctaaattcaccaagtgtcgttcacctgag
cgagagactttttcatgccactggacagatgcggttcatcatggttcaaagagcctagga
cccatacagctgttctataccagaagaaatattcaagaatggactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcatttacctcc
atctggataccttattgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgacgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatattcaagtgagatgggaagcaccacccaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggatcctatattgtcaacatcagttccagtgtactctttg
aaagtggataaggaatatgaagtgcgtgtgagatccaaacaacgaaactctggaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgaaccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttgggctaacagtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaattgatccagatctcctcaaggaaggaaaattagag
gaggtgaacacaattttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagaatgagggatca
gacacagacagacttctaagcagtgaccatcagaaatcacatagtaacctaggggtgaag
gatggcgactctggacgtaccagctgttacgaacctgacattctggagactgatttcaat
gccaatgacatacatgagggtacctcagaggttgctcagccgcagaggttaaaaggggaa
acagatctcttatgccttgaccagaagaatcaaaataagtcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgatggagctgagtcaactcatcaagctgcccatattcagctaagcaatccaagttca
ctggcaaacatcgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccaggccaaaagaataaggcagggatgtcccagtgtgacatgcacctggaaatg
gtctcactctgccaagaaaacttcattatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacatcaaggttgaatcacacatagagccaagcttt
aaccaagaggatatttacatcaccaccgaaagccttaccactactgctgggaggcctggg
acaacagaacatattccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcgtgtggctatgtgagcacagaccaactgaacaaaatcatgccttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669027
Entry
104669027         CDS       T03989                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor isoform X2
  KO
K05082  thrombopoietin receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104669027 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104669027 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104669027 (MPL)
   04090 CD molecules [BR:rro04090]
    104669027 (MPL)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  Prolactin receptor family
   104669027 (MPL)
CD molecules [BR:rro04090]
 Proteins
  104669027 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LapA_dom
Other DBs
NCBI-GeneID: 104669027
NCBI-ProteinID: XP_010370175
UniProt: A0A2K6RPT5
LinkDB
Position
12
AA seq 635 aa
MPSWALFMVTSCLLLAPPNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPGEKPRACPLSYQSMPRFGTRYVCQFPAQEEVRLFFPLHLWVKNVFLNQTR
IQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEAPAPEISDFLRYELRYGPKGLKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPQQTSPTREASALTVGGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVAIGLQCFTLDLKNVT
CQWQQEDHASSQGFFYHSRARCCPRDRYPIWEDCEEEEKTDPGLQTSQFSRCHFKSRNDS
VIHILVEVTTAPGAVHSYLGSPFWIHRAVRLPTPNLYWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
AKVETATDTAWISLVTALLLALGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQSQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgccctcctgggctctcttcatggtcacctcctgcctcctcctggcccctccaaacctg
gcccaagtcagcagccaagatgtctccttgctggcctcggactcagagcccctgaagtgt
ttctctcgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcacccagt
gggacataccagctgctgtatgcctacccgggggagaagccccgtgcctgccccctgagt
tatcagagcatgccccgctttggaacccgatacgtgtgccagtttccagcccaggaagaa
gtgcgtctcttctttccgctgcacctctgggtgaagaatgtgttcctaaaccagactcgg
attcagcgagtcctctttgtggacagtgtaggcctgccggctccccccagtatcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggccccagctccagaa
atcagtgatttcctgaggtacgaactccgctatggccccaaaggtctcaagaactccact
ggtcccacggtcatacagttgatcgccacagaaacctgctgccctgctctgcagaggcca
cactcagcctctgctctggaccagtctccatgtgctcagcccacaatgccctggcaagat
ggaccacagcagacctccccaactagagaagcttcagctctgacagtagggggtggaagc
tgcctcatctcaggactccagcctggcaactcctactggctgcagctgcgcagtgaacct
gatgggatctcccttggtggctcctggggatcctggtccctccctgtgactgtggacctg
cctggagatgcagtggcaattggactgcaatgctttaccttggacctgaagaatgttacc
tgtcaatggcagcaagaggaccatgctagctcccaaggtttcttctaccacagcagggca
cgatgctgccccagagacaggtaccccatctgggaagactgtgaagaggaagagaaaaca
gatccaggattacagacctcacagttctctcgctgccacttcaagtcacgaaatgacagc
gttattcacatccttgtggaggtgaccacagccccgggtgctgttcacagttacctgggc
tcccctttctggatccaccgggctgtgcgcctccccaccccaaacttgtactggagggag
atctccagtggccatctggaattggagtggcagcacccatcgtcctgggcagcccaagag
acctgctatcaactccgatacacaggagaaggccatcaggactggaaggtgctggagccg
cctctcggggcccgaggagggaccctggagctgcgcccgcgatctcgctaccgtttacag
ctgcgcgccaggctcaatggccccacctaccaaggtccctggagctcgtggtcggaccca
gctaaggtggagaccgccaccgacaccgcctggatctccttggtgaccgctctgctctta
gcgctgggcctcagcgccgtcctgggcctgctgctgctgaggtggcagtttcctgcacac
tacaggagactgaggcatgccctgtggccctcacttccagatctgcaccgagtcctaggc
caataccttagggacactgcagccctgagtccgcccaaggccacagtctcagatacctgt
gaagaagtggaacccagcctccttgaaatcctccccaagtcctcagagaggactcctttg
cccctgtgttcctcccagtcccagatggactaccgaagattgcagccttcttgcctgggg
accatgcccctgtctgtgtgcccacccatggctgaatcagggtcctgctgtaccacccac
attgccaaccattcctacctaccactaagctattggcagcagccttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669797
Entry
104669797         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-9 receptor-like
  KO
K05073  interleukin 9 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104669797
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104669797
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104669797
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104669797
   04090 CD molecules [BR:rro04090]
    104669797
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104669797
CD molecules [BR:rro04090]
 Proteins
  104669797
SSDB
Other DBs
NCBI-GeneID: 104669797
NCBI-ProteinID: XP_030782198
LinkDB
Position
22
AA seq 483 aa
MGSTPPERAGSHRPSAQPLAGWTLEREALRRHXGTWLLACTCVCTCVRSGVSVSGVGXGP
RTGNFTCLTNNLLRIDCRWSVPELGQGSSPGLLFTSNRAPDGTRKCISWVSECTVVLPPE
AVLLPSNNFIITFHHCVSGREQVSLVELQYLPWRHVKLDPLSDLQSNVSSGHCILTWSIS
PALQLTTTLLSYELGFKRQEEAWECACMCLCVHTCALRLLIAPGPFLPTGSLIPPWGWPG
STFVAVSVFLLLTGLTYLLFKPSPRVKRTFYQNVPSPAAFFRPLYSVHNGNFQTWMGAHR
AGMLLSWDCAAGTPRGASETCVQEATALLTCGPSGPWKSVVLEEEQEGTGTSLLGNLSSE
NVLPAGCTEWRAQLLAYLPQDDWTPTSPTRPAPPDSEGNSNSSDYCALSCYRGCHPSALP
GNMQSPGPIPALACGLFCDHQGLETQQGGAWVLAGHCQRPGLHEDRQGTLLPSVLSKALS
WTF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggggagcacccctccagagagggctggctcgcacaggccctcagcccagccccttgca
ggctggaccttggagagggaggccctgaggcgacacnatggcacctggctcctggcctgc
acctgcgtctgcacctgtgtccgctcgggagtctctgtctcaggggttggatgaggacca
aggactggaaacttcacctgcctcaccaacaaccttctcaggatcgattgccgctggtct
gtcccagagctgggccagggctccagccccgggctcctcttcaccagcaatagggctcct
gatggcacacgtaagtgcatatcgtgggtcagtgagtgcactgtagtgctgccacccgag
gctgtgctcctgccatccaacaatttcatcatcactttccaccactgcgtgtctgggagg
gagcaggtcagcctggtggagctgcagtacctgccctggagacacgtgaagctggaccca
ctctctgatttgcagagcaatgtcagctctggccactgcatcttgacctggagcatcagt
cctgccttgcagctgacgaccacacttctcagctatgagctgggattcaagaggcaggaa
gaggcctgggagtgtgcgtgtatgtgtttatgtgtgcacacatgtgcactgaggctgctc
atagcccctgggcccttcctgcccacaggctctctgatcccaccctgggggtggccaggc
agcacctttgttgctgtgtctgtctttcttctgctgactggcctgacctacctcctgttc
aagccatcacccagggtgaagagaaccttctaccagaacgtgccctctccagcggcgttc
ttccggcccctctacagtgtgcacaatgggaacttccagacttggatgggggcccacagg
gctggtatgctgctgagctgggactgtgctgctggcaccccacgaggagcctcggagacc
tgcgtccaggaggccactgcactgctcacctgtggcccatcgggtccttggaaatctgtg
gtcctggaggaggagcaggagggcactgggaccagcctcctggggaacctgagctcagag
aatgtgctgccagcagggtgtacggagtggagggctcagctgcttgcctatctgccacag
gatgactggacccccacatcccccaccaggccagctcccccagactcagagggcaacagt
aacagcagtgactactgtgccttgagctgctacaggggatgccacccctcagccctccca
ggtaacatgcagagccctgggcccatcccagccctggcctgtggccttttctgtgaccat
cagggcttggagacccagcaaggaggtgcctgggtgctggctggtcactgccagaggccc
gggctgcatgaagaccgccagggcacgttgctcccttccgtcctcagcaaggctctgtcc
tggacgttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670204
Entry
104670204         CDS       T03989                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor isoform X1
  KO
K05075  interleukin 21 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670204 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670204 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104670204 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    104670204 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104670204 (IL21R)
   04090 CD molecules [BR:rro04090]
    104670204 (IL21R)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104670204 (IL21R)
CD molecules [BR:rro04090]
 Proteins
  104670204 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T EpoR_lig-bind
Other DBs
NCBI-GeneID: 104670204
NCBI-ProteinID: XP_030781132
LinkDB
Position
20
AA seq 565 aa
MSCRCIFLMRHGERVGWPVGVSMLRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILE
MWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNI
TDHSGNYSQECGSFLLAKSRFSHQVKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGK
LQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGT
WSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPMWRLWKKIWAVPSP
EQFFMPLYEGCSGDFKKWVGAPFTGSRLELGSWSPEVPSALEVYSCHPPQSPAKRLQLTE
LREPAELVESDSVPKPSFWATAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCS
CEDDGYPALDLDAGLEPSPGLEDPLLGAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPL
ADGEDWAGGLSWGGRSPGGVSESEAGSPPAGLDMDTFDSGFVGSDCSSPVECDFTSPGDE
GPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgagctgtcgctgcatctttctcatgaggcacggggaacgcgtcggatggcctgtagga
gtcagcatgctgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctgg
ggctgccctgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggag
atgtggaacctccaccccagcacactcacccttacctggcaagaccagtatgaagagctg
aaggacgaggccacctcctgcagcctccacaggtcggcccacaatgccacgcacgccacc
tacacctgccacatggatgtattccacttcatggccgacgacattttcagtgtcaacatc
acagaccactctggcaactactcccaggagtgtggcagctttcttctggctaagagcagg
ttttcccaccaagtcaagccggctccccctttcaacgtgactgtgaccttctcaggacag
tataatatctcctggcgctcagattacgaagaccctgccttctacatgctgaagggcaag
ctccagtatgagctgcagtacagaaaccggggagacccctgggctgtgagtccgaggaga
aagctgatctcagtggactcaagaagtgtctccctcctccccctggagttccgcaaagac
tcaagctatgagctgcaggtgcgggcagggcccatgcctggctcttcctaccaggggacc
tggagtgagtggagtgacccggtcatctttcagacccagtcagaggagttaaaggaaggc
tggaaccctcacctgctgcttctcctcctgcttgtcatagtcttcattcctgccttctgg
agcctgaagacccacccaatgtggaggctatggaagaagatatgggccgtccccagcccc
gagcagttcttcatgcccctgtacgagggctgcagcggagacttcaagaagtgggtgggt
gctcccttcactggctccaggctggagttgggatcctggagcccagaagtgccctcagcc
ctggaggtgtacagctgccacccaccacagagcccggccaagaggctgcagctcacggag
ctacgggagccagcagagctggtggagtctgacagcgtgcccaagcccagcttctgggcg
acggcccagaactcaggaggctcagcttacagtgaggagagggaccggccgtacggcctg
gtgtccatcgatacagtgactgtgctagatgcagaggggccatgcacctggccctgcagc
tgtgaggatgacggctacccagccctggacctggatgctggcctggagcccagcccaggc
ctagaggatccactcttgggcgcgggaaccacagtcctctcctgtggctgtgtctcagct
ggcagccctgggctaggagggcccctgggaagcctcctggacagactaaagccacccctt
gcagatggggaggactgggctgggggactgtcctggggtggccggtcgcccggaggggtc
tcagagagtgaggcgggctcgcccccggctggcctggatatggacacgtttgacagtggc
ttcgtgggctctgactgcagcagccctgtggagtgtgacttcaccagccccggggatgaa
gggcccccccggagctacctccgccagtgggtggtcattcccccgccactttcaagccct
ggaccccaggccagctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670408
Entry
104670408         CDS       T03989                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04072  Phospholipase D signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04630  JAK-STAT signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104670408 (PDGFRB)
   04014 Ras signaling pathway
    104670408 (PDGFRB)
   04015 Rap1 signaling pathway
    104670408 (PDGFRB)
   04630 JAK-STAT signaling pathway
    104670408 (PDGFRB)
   04020 Calcium signaling pathway
    104670408 (PDGFRB)
   04072 Phospholipase D signaling pathway
    104670408 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    104670408 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670408 (PDGFRB)
   04540 Gap junction
    104670408 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104670408 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670408 (PDGFRB)
   05206 MicroRNAs in cancer
    104670408 (PDGFRB)
   05230 Central carbon metabolism in cancer
    104670408 (PDGFRB)
   05231 Choline metabolism in cancer
    104670408 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    104670408 (PDGFRB)
   05218 Melanoma
    104670408 (PDGFRB)
   05215 Prostate cancer
    104670408 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104670408 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104670408 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104670408 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rro04090]
    104670408 (PDGFRB)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104670408 (PDGFRB)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104670408 (PDGFRB)
CD molecules [BR:rro04090]
 Proteins
  104670408 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 104670408
NCBI-ProteinID: XP_010371930
UniProt: A0A2K6R8D5
LinkDB
Position
3
AA seq 1106 aa
MQLPGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELILNVSSTFVLTCLGSAPV
VWERMSQKPPQEMAKAQDSTFSSVLTLTNLTGLDTGEYFCTYNDSRGLEPDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEVTEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVENGYVRLLGEVGALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDMQEVIVVPHSLPFKAVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDSSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEAEPEPQLERQV
EPEPELEQLPDSGCPAPRAEADDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcagcttccgggtgcgatgccagctctggccctcaaaggccagctgctcttgctgccc
ctgctgttattgctggaaccgcaggtctctcagggcctggtcatcacacccccgggacca
gagcttatcctcaatgtctccagcacctttgttctgacctgcttgggttcagctcccgtg
gtgtgggaacggatgtcccagaagcccccacaggaaatggccaaggcccaggacagcacc
ttctccagtgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acctacaatgactcccgtggactggagcccgatgagcggaaacggctctacatctttgta
ccagatcccaccgtgggcttcctccctaatgacgccgaggaactattcatctttctcacg
gaagtaactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctacgatcaccagcgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgatgcctactatgtctacagactccaggtgtcatccatcaacgtctccgtgaatgca
gtgcagactgtggtccgccagggtgagaacattaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacgtacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaacgtgacagagagtgtgaacgaccat
caggatgaaaaggccatcaacatcactgtggttgagaacggctatgtgcggctcctggga
gaggtgggagcactacaatttgctgagctgcaccggagccggacactgcaggtagtgttc
gaggcctacccaccacccaccgtcctgtggttcaaagacaaccgcaccttgggcgactcc
agcgctggcgagatcgccctgtccacgcgcaacgtgtcagagacccggtatgtgtcagag
ctgacactcgttcgggtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgcgtgctg
gagctaagtgagagccacccagacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccaaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccatgctgctggggaacagttctgaagaggagagccagctggagacgaacgtg
acatactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacatgcaggag
gtcatcgtggtgccacactctttgcccttcaaggcggtggtgatctcagccatcctggcc
ctggtggtcctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgatggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgttacggagacctggtggactacctgcaccgcaacaagcacaccttc
ctgcagcaccattccgacaagcgccgcccgcccagcgcggagctctacagcaatgcactg
cccgttgggctccccctgcccagccatgtgtccctgactggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactacgtgcccatgctggacatgaaaggagat
gtcaaatatgcagacatcgagtcctccaactacatggccccttacgataactacgttccc
tctgcccctgagaggacctgtcgggcaactttaatcaatgagtctccggtgctaagctac
atggaccttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aactgcgtccaccgagacctggcagccaggaacgtgctcatctgcgagggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagtacctttttgcctttgaagtggatggctccagagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcactttgggt
ggcaccccttacccagagctgcccatgaatgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccacgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccctttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcccgggttccatggcctccgatct
cccctggacagcagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcgaccatctcctgt
gacagccctctggagccccaggaggaagcagagccagagccccagcttgagcgccaggtg
gaaccagagccagagctggaacagctgccggattcagggtgccccgcgcctcgagcagaa
gcagacgacagcttcctgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670444
Entry
104670444         CDS       T03989                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670444 (EPOR)
   04151 PI3K-Akt signaling pathway
    104670444 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670444 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104670444 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670444 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104670444 (EPOR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  Prolactin receptor family
   104670444 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 104670444
NCBI-ProteinID: XP_010372006
UniProt: A0A2K6RF53
LinkDB
Position
8
AA seq 508 aa
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPDNYNFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRIIHINEVVLLDAPVGLVARLADEGGHIVLRWLPPPEAPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVLILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SGHAQDTYLVLDKWLLPRNPPSEDLPGPAGSVDTVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWALSPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDSPYSNPYENSLIPAAEPLPPSYLACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggaccaccttggggcgtccttgtggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcccaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggcggcccgcggacccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagtgctggggtgggcccagacaactacaacttctcc
taccagctcgaggatgagccatggaagctttgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcctacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtatcatccacatcaat
gaagtagtgctcctggacgcccccgtggggctggtggcgcggctggctgacgagggcggc
cacatagtgttgcgctggctcccgccgcctgaggcacccatgacgtcccacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtgcagagggtggagatcctggag
ggccgcaccgaatgtgtgctgagcaacctcaggggccggacgcgctacaccttcgccgtc
cgcgcgcgcatggctgagccgagcttcggcggcttctggagcgcctggtccgagcctgtg
tcgctgctgacgcctagcgacctggaccccctcatcctgacgctctccctcatcctcgtg
ctcatcctggtgctgctgaccgtgctcgccctgctctcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagcgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaacgacggctgcctgtggtggagcccctgc
acccccttcacagaggacccacctgcctccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccggtgggc
agtgggcatgcccaggatacctatctggtgctggacaaatggttgctgccccggaacccg
cccagtgaggacctcccagggcctgctggcagtgtggacacagtggccatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcctagcccagagggagcctct
gctgccagcttcgagtacaccatcctggaccccagctcccagctcttgcgtccatgggca
ctgtcccctgagctgccccctaccccaccccacctaaagtacctgtaccttgtcgtatct
gactctggcatctcaactgactacagctcaggggactcccagggagcccaagggggctta
tccgacagcccctactccaacccttatgagaacagccttatcccagccgctgagcctcta
ccccctagctatctggcttgctcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675018
Entry
104675018         CDS       T03989                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha isoform X1
  KO
K05136  interleukin 20 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675018 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104675018 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104675018 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104675018 (IL20RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104675018 (IL20RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 104675018
NCBI-ProteinID: XP_010377786
UniProt: A0A2K6NC96
LinkDB
Position
4
AA seq 548 aa
MRAPSSPALRPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWNPPECLQGV
KVTYTVQYFIYGQKKWLNKSECRNINRTCCDLSAETSDYEHQYYAKVKAIWGTNCSKWAE
SGRFYPFLETQIGPPEVALTTDEKSISVVLTPPEKWKRNPEDLPVSMQQIYSNLKYNVSV
SNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSS
EFKAKIIFWYVLPVSVTVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRFFVPAE
KIVINFITLNISDDSKICHQDMSLLGKSSDVSSLNDPQPSGNLKPPQEEEEVKHLGYASH
LMEIFCDSEEDAEGTSFTQQESLIRTIPPDKTVIEYEYDVRTTDICAGPEEQELRLQEEV
STQGTLLESQAALAILGRQTLQYSYTPQLRDLDSLTREHTDSERGPEEEPSTTLVDWDPQ
TGRLCIPSLSSFDQDSEGCEPSEGDGFGEEGLLSRLYEEPAPDKPPGENETYLMQFMEEW
GLYVQMEN
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcgggctcccagcagcccggccctgaggccgctgctgctgctgcttctggcggcgccg
tggggacgggcagttccctgtgtctctggtggtttgcctaaacctgcaaacattaccttc
ttatccatcaacatgaagaatgtcctacaatggaatccaccagagtgtcttcaaggagtt
aaagttacttacactgtgcagtatttcatatatgggcaaaagaaatggctgaataaatca
gaatgcagaaatatcaatagaacctgctgtgatctttctgctgaaacttctgactacgaa
caccagtattatgccaaagttaaggccatttggggaacaaactgttccaaatgggctgaa
agtggacggttctatccttttttagaaacacaaattggcccaccagaggtggcactgact
acagatgagaagtccatttctgttgttctaacacctccagagaagtggaagagaaatcca
gaagaccttcctgtttccatgcaacaaatatactccaatctgaagtataatgtgtctgtg
tcgaatactaaatcaaatagaacgtggtcccagtgtgtgaccaaccacacgctagtgctc
acctggctggagccaaacactctttactgtgtccacgttgagtccttcgtcccagggccc
cctcgccgtgctcagccttctgagaagcagtgtgccaggactttgaaagatcaatcatca
gagttcaaagctaaaatcatcttctggtatgttctgcccgtatccgttactgtgtttctt
ttttctgtgatgggctattccatctaccgatatatccacgttggcaaagagaaacaccca
gcaaatttgattttgatttatggaaatgaatttgacaaaagattctttgtgcctgctgaa
aaaatcgtgattaactttatcaccctcaatatctcggatgattctaaaatttgtcatcag
gatatgagtttactgggaaaaagcagtgatgtatccagccttaatgatcctcagcctagc
gggaacctgaagccccctcaggaggaagaggaggtgaaacatttagggtatgcttcgcat
ttgatggaaattttttgtgattctgaagaagacgcagaaggtacttccttcacccagcaa
gagtccctcatcagaacaatacccccagataaaacagtcattgaatatgaatatgatgtc
agaaccactgacatttgtgcagggcctgaagagcaggagctcaggttgcaggaggaggtg
tccacacaaggaacattattggagtcacaggcagcgttggcaatcttgggccggcaaaca
ttacagtactcatacacccctcagctccgagacttagactccctgacgcgggagcacaca
gactcagagcgggggccagaggaagagccatcgacgaccctggtcgactgggacccccaa
actggcaggctgtgtattccttcgctgtccagcttcgaccaggactcagagggctgcgag
ccttccgagggggatggattcggggaggagggtcttctgtctaggctctatgaggagccg
gctccagacaagccaccaggagaaaatgaaacctatctcatgcaattcatggaggaatgg
gggttatatgtgcagatggaaaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675020
Entry
104675020         CDS       T03989                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2 isoform X1
  KO
K05139  interleukin 22 receptor alpha 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675020 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104675020 (IL22RA2)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL10/28 receptor family
   104675020 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind SCPU
Other DBs
NCBI-GeneID: 104675020
NCBI-ProteinID: XP_010377789
UniProt: A0A2K6N8Y3
LinkDB
Position
4
AA seq 231 aa
MRPKHCFLGFLISFFLTGIAGTQPAHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
FVQYKIYGQRQWKNKEDCWGTQELFCDLTSETSDIQEPYYGRVRAASAGSYSDWSMTPRF
TPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNISIEDYYELVYRVFIITNSL
EKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaggcctaaacattgctttctaggcttcctcatcagtttcttccttactggtatagca
ggaactcagccagcacatgagtctctgaagcctcagagggtacaatttcagtcccgaaat
tttcacaacattttgcaatggcagcctgggagggcacttactggcaacagcagtgtctat
tttgtgcagtacaaaatatatggacagagacaatggaaaaataaagaagactgttggggt
actcaagaactcttttgtgaccttaccagtgaaacctcagacatacaggaaccttattac
gggagggtgagggcagcctcggctgggagctactcagactggagcatgacgccgcggttc
actccctggtgggaaacaaaaatagatcctccagtcatgaatataacccaagtcaatgga
tctttgttggtaattctccatgctccaaatttaccatatagataccaaaaggaaaaaaat
atatctatagaagattactatgaactagtataccgagtttttataataaccaattcacta
gaaaaggagcaaaaggtttatgaaggggcccacagagctgttgaaattgaagctctaaca
ccacattccagctactgtgtagtggctgaaatatatcagcccatgttagacagaagaagt
cagagaagtgaagagagatgtgtggaaattccatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675021
Entry
104675021         CDS       T03989                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04066  HIF-1 signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05200  Pathways in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675021 (IFNGR1)
   04066 HIF-1 signaling pathway
    104675021 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104675021 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104675021 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104675021 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    104675021 (IFNGR1)
   04659 Th17 cell differentiation
    104675021 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104675021 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675021 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104675021 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104675021 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104675021 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    104675021 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    104675021 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104675021 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104675021 (IFNGR1)
   05140 Leishmaniasis
    104675021 (IFNGR1)
   05142 Chagas disease
    104675021 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104675021 (IFNGR1)
   04090 CD molecules [BR:rro04090]
    104675021 (IFNGR1)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IFN receptor family
   104675021 (IFNGR1)
CD molecules [BR:rro04090]
 Proteins
  104675021 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 104675021
NCBI-ProteinID: XP_010377792
UniProt: A0A2K6Q117
LinkDB
Position
4
AA seq 489 aa
MALLFLLILVMQSVSRAEMVTADLGQSSVPIPTNVTIESYNMNTIVYWEYQSMPQVSVFT
VEVKNYGVKNAEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAESKEFA
VCRDGKIGPPKLDIRKEEKQIMIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SNIKGSLWIPVVAALLLFLVLSLVLICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKGEHTEELSSITEVVTTEE
NIPDMAPGSHLTPIERESSSPFSSNQSEPCSVALNSYHSRNCSDSDHSRNGFDTDSSCLE
SHNSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDGRKESLIGYR
PTEGSKEFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctctcctctttcttctgatccttgtcatgcagagtgtgagcagggctgagatggtc
accgcggatctggggcagtcctcagtgcctataccaactaatgttacaattgagtcctat
aacatgaacaccatcgtatattgggagtaccagagcatgccacaggtctctgtttttact
gtagaggtaaagaactatggtgttaagaatgcagaatggattgatgcctgcatcaatatt
tctcatcattattgtaatatttctgatcatgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcagagtcaaaagaatttgct
gtgtgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatgattgacgtatttcacccttcagtttttgtaaatggagaagagcaggaagtcgat
tatgatccagaaactacctgttacattaaggtgtacaatgtgtatgtgagaatgaatgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgcgacgagattcagtgc
cagttagcgattccagtgtcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtatggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcaacataaaaggttctctttggattccagttgttgctgctttactactctttctagta
cttagcctggtattgatctgtttttatattaagaagattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtcagaagtgctactttagagacaaaacct
gaatcaaaatatgtatcactcatcacatcataccagccattttccttagaaaaggaggtg
gtctgtgaagagccgttgtctccagcaacagttccaggcatgcatactgaagacaatcca
ggaaaaggagagcatacagaagaactttctagtataacagaagtggtgactactgaagaa
aacattcctgacatggccccgggcagccatctgactccaatagagagagagagttcttca
cctttcagtagtaaccagtctgaaccctgcagcgtcgctttaaactcctatcactccaga
aattgttctgatagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacataactccttatctgattcagaatttcccccaaataataaaggtgaaataaaaaca
gaaggacaagagctcataacagtaataaaagcccccacctcctttggttatgataaaccg
cacgtgctagtggatctacttgtggatgatggccgtaaagagtccttgattggttacaga
ccaacagaaggttccaaagaattttcatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675886
Entry
104675886         CDS       T03989                                 

Gene name
EGFR
Definition
(RefSeq) LOW QUALITY PROTEIN: epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04540  Gap junction
rro04630  JAK-STAT signaling pathway
rro04810  Regulation of actin cytoskeleton
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104675886 (EGFR)
   04012 ErbB signaling pathway
    104675886 (EGFR)
   04014 Ras signaling pathway
    104675886 (EGFR)
   04015 Rap1 signaling pathway
    104675886 (EGFR)
   04630 JAK-STAT signaling pathway
    104675886 (EGFR)
   04066 HIF-1 signaling pathway
    104675886 (EGFR)
   04068 FoxO signaling pathway
    104675886 (EGFR)
   04020 Calcium signaling pathway
    104675886 (EGFR)
   04072 Phospholipase D signaling pathway
    104675886 (EGFR)
   04151 PI3K-Akt signaling pathway
    104675886 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104675886 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675886 (EGFR)
   04520 Adherens junction
    104675886 (EGFR)
   04540 Gap junction
    104675886 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675886 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104675886 (EGFR)
   04915 Estrogen signaling pathway
    104675886 (EGFR)
   04921 Oxytocin signaling pathway
    104675886 (EGFR)
   04926 Relaxin signaling pathway
    104675886 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    104675886 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675886 (EGFR)
   05206 MicroRNAs in cancer
    104675886 (EGFR)
   05205 Proteoglycans in cancer
    104675886 (EGFR)
   05230 Central carbon metabolism in cancer
    104675886 (EGFR)
   05231 Choline metabolism in cancer
    104675886 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104675886 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104675886 (EGFR)
   05212 Pancreatic cancer
    104675886 (EGFR)
   05225 Hepatocellular carcinoma
    104675886 (EGFR)
   05226 Gastric cancer
    104675886 (EGFR)
   05214 Glioma
    104675886 (EGFR)
   05218 Melanoma
    104675886 (EGFR)
   05219 Bladder cancer
    104675886 (EGFR)
   05215 Prostate cancer
    104675886 (EGFR)
   05213 Endometrial cancer
    104675886 (EGFR)
   05224 Breast cancer
    104675886 (EGFR)
   05223 Non-small cell lung cancer
    104675886 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104675886 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104675886 (EGFR)
   05171 Coronavirus disease - COVID-19
    104675886 (EGFR)
   05163 Human cytomegalovirus infection
    104675886 (EGFR)
   05165 Human papillomavirus infection
    104675886 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104675886 (EGFR)
   01522 Endocrine resistance
    104675886 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104675886 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104675886 (EGFR)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104675886 (EGFR)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   104675886 (EGFR)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104675886 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   104675886 (EGFR)
  Exosomal proteins of bladder cancer cells
   104675886 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 104675886
NCBI-ProteinID: XP_010378850
UniProt: A0A2K6R6K2
LinkDB
Position
6
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSNFLSNMSMDF
QNHLGSCQKCDPGCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGSGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcactagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctatgtgcagaggaattacgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacactgtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcaactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaggctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgtggcaagtcccccagtgattgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacgtaccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggcggacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggaccttcatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattgcgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggtgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacgggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctatggatgcactgggtcaggtcttgaaggctgtgcaaggaacggg
cctaagatcccgtccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctgggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccaaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagcttatcacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacagattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtagatgccgacgagtacctcatcccacag
cagggcttcttcagcagcccctccacatcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678745
Entry
104678745         CDS       T03989                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104678745 (PRLR)
   04151 PI3K-Akt signaling pathway
    104678745 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104678745 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    104678745 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104678745 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104678745 (PRLR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  Prolactin receptor family
   104678745 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind GHBP
Other DBs
NCBI-GeneID: 104678745
NCBI-ProteinID: XP_010382384
UniProt: A0A2K6NVZ7
LinkDB
Position
3
AA seq 619 aa
MKENVVSATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELTVEVKQPEDRKPYLWMKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
ETHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFIMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLIQ
HNPRSSYHNITDVCELAVGPADAPATLLDEAGKDALKSSQTIKSREEGKAAQQREVESFH
SKTDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGQPEKPRAPENS
KEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEVPPSLEQNQAEKDLANFTATPSKCR
IQLGGLDYLDPACFTHSFH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgtggtatctgcaactgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcccaccaattat
tcactgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataact
ggtgggcccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactttacgtggac
gtgacttacatagttcaaccagaccctcctttggagctgactgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggatgaaatggtctccacctaccctgattgacttaaaa
actggttggttcacactcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagacccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagatcatggatattggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcatcatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgacagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgctggtggatccaaatgttcaacatggcccttaatacag
cacaaccccagatcctcctaccacaatattactgatgtgtgtgagctggctgtgggtcct
gcagatgcaccggccactctgttggacgaagcaggtaaagatgctttaaaatcctctcaa
accattaagtctagagaggagggaaaggcagcccagcagagggaggtggaaagcttccat
tccaagactgaccaagatacgccctggctgctgccccaggagaaaaccccctttggctcc
gctaaacctttggattatgtggagattcacaaggtcaacaaagatggcgcattatcattg
ctaccgaaacagagagagaacagcggccagcccgagaagcccagggctcctgagaacagt
aaggagtatgccaaagtgtccggggtcatggataacaacatcctggtgttggtgccggat
ccacatgctaaaaatgtggcttgctttgaagaatcagccaaagaggtcccaccatcactt
gaacagaatcaagctgagaaagacctggccaacttcactgcgacaccaagcaagtgcagg
atccagctgggtggtttggattacctggatcccgcgtgttttacgcactcctttcattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680008
Entry
104680008         CDS       T03989                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680008 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104680008 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104680008 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104680008 (CNTFR)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104680008 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Receptors
  104680008 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 104680008
NCBI-ProteinID: XP_010384090
UniProt: A0A2K6RJC0
LinkDB
Position
16
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYTQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAVETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSIPITLAL
AAAAATASSLMI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgcgctgtgcttgctgctgccgctgcagttgtc
tacacccagagacacagtccacaggaggcaccccatgtgcagtacgagcgcctaggctcc
gacgtgacactgccatgtgggacagcaaactgggatgcagcagtgacgtggcgggtaaac
gggacagacctggcccctgacctgctcaacggctctcagctggtgctccgtggcctggaa
ctgggccacagtggcctgtacgcctgcttccaccgtgactcctggcacctgcgccaccaa
gtcctgctgcatgtgggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacattcccaacacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcgctacatgcacctgttctccaccatcaagtacaaggtctct
ataagtgtcagcaatgccctgggccacaatgccacagctatcacctttgatgagttcacc
attgtgaagcctgatcctccagaaaatgtggtagcccggccagtgcccagcaaccctcgc
cgactggaggtgacgtggcagaccccctcgacctggcctgaccctgagtcttttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtct
gatggcacagcacacaccatcacagatgcctatgccgggaaggagtacattatccaggtg
gcagccaaggacaatgaaattgggacatggagtgactggagcgtggctgcccatgctacg
ccctggactgaggaaccgcgacacctcactacggaggcccaggccgtggagaccacgacc
agcaccaccagctccctggcacccccacctaccacgaagatctgtgacccgggggagctg
ggcagcggcgggggaccctcggcacccttcttggtcagcatccccatcactctggccctg
gctgccgctgctgccactgccagcagtctcatgatctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680015
Entry
104680015         CDS       T03989                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X2
  KO
K05056  interleukin 11 receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680015 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104680015 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104680015 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104680015 (IL11RA)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104680015 (IL11RA)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig EpoR_lig-bind I-set
Other DBs
NCBI-GeneID: 104680015
NCBI-ProteinID: XP_010384102
UniProt: A0A2K6RH39
LinkDB
Position
16
AA seq 422 aa
MSSGCSGLSRVLVAVATALVSASSSCPQAWGPSGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPRLLQGPDSGLGHELVLTQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGFPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTVPKEVPAWGQLHMQPEVEPQVDSPAPPRPSLQPHPRLLDHR
DSLEQVAVLASLGILSFLGLMAGALALGLWLRMRRGGKDGSPKPGFLAPMIPVDRCPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcggctgctcagggctgagcagggtcctggtggccgtggctacagccctggtg
tctgcctcctcctcctgcccccaggcctggggcccctcaggggtccagtatgggcagccc
ggcaggtccgtgaagctgtgttgtcctggagtgactgccggggacccagtgtcctggttt
cgggacggggagccaaggctgctccagggacctgactctgggctagggcatgaactggtc
ctgacccaggcagacagcactgatgagggcacctacatctgccagacgctggatggtgca
cttgggggcacagtgaccctgcagctgggctaccctccagcccgccctgttgtctcctgc
caagcagctgactatgagaacttctcttgcacttggagtcccagtcagatcagcggttta
cccacccgctacctcacctcctacaggaagaagacagttctaggagctgatagccagagg
aggagtccatccacagggccctggccatgcccacaggatcccctaggtgctgcccgctgt
gttgtccacggggctgagttctggagccagtaccggattaatgtgactgaggtgaaccca
ctgggcgccagcacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
ccccagggcctgcgggtagagtcggtaccaggtttcccccgacgcctgcgagccagctgg
acataccctgcctcctggccgcgccagccccacttcctgctcaagttccgtttgcagtac
cgtccggcacagcatccagcctggtccacggtggagccagctggactggaggaggtgatc
acagatgctgtagctgggctaccccatgccgtacgagtcagtgcccgggactttctggat
gctggcacctggagcacctggagcccggaggcctggggaactccgagcactgggaccgta
ccaaaggaggtaccagcttggggccagctacacatgcagccagaggtggagcctcaggtg
gacagccctgctcctccaaggccctccctccaaccacaccctcggctacttgatcacagg
gactctctggagcaggtagctgtactggcgtctttgggaatcctttctttcctgggactg
atggctggagccctggcactggggctctggctgaggatgagacggggcgggaaggatgga
tccccaaagcctgggttcttggccccaatgattccagtggacaggtgtccaggagctcca
aacctatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680478
Entry
104680478         CDS       T03989                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680478 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104680478 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104680478 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104680478 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104680478 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680478 (IL6ST)
   05203 Viral carcinogenesis
    104680478 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104680478 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680478 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104680478 (IL6ST)
   04090 CD molecules [BR:rro04090]
    104680478 (IL6ST)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104680478 (IL6ST)
CD molecules [BR:rro04090]
 Proteins
  104680478 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N fn3_2 Interfer-bind ObR_Ig DCP1
Other DBs
NCBI-GeneID: 104680478
NCBI-ProteinID: XP_010384765
UniProt: A0A2K6QWJ5
LinkDB
Position
3
AA seq 918 aa
MLTWQTWLVPALFIFLTTESIGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDISSLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWSCGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIRLKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEANGITYEDRPSKAPSFWYKIDPSHAQGYRTVQLMWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNDTKLTVNLTNDRYVATLTARNLVGKSDGAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCIADWQQEDGTVHRT
HLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGSDDILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRIKQQISDHISQSCGSGEMKMFQEVSAADAFGPGTEGQVERFETIGMEAAIDEG
MPKSYLPQTVRQGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacgtggcagacttggctagtgccagccttgtttatttttctcaccactgaatca
ataggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaactacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcatccagtgtcacctttacagatatatcttcattaaatattcag
ctcacttgcaacatccttacattcggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaatgagggaaag
aaaatgaggtgtgagtggagttgtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttggaaaggttacgtcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataagactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagatacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaaatgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
gctcaaggctatagaactgtacaactcatgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattac
acagttaatgacacaaaactgacagtaaatctcacaaatgatcgctatgtagcaaccctg
acagcaagaaatcttgttggcaaatcagatggagctgttttaactatccctgcctgtgac
tttcaagctactcaccctgtaatggatcttaaagcattccccaaagataacatgctttgg
gtagaatggactactccaagggaatctgtaaagaaatatatacttgagtggtgtgtgtta
tcagataaagcgccctgtatcgcagactggcaacaggaagatggtactgtgcatcgcacc
catttaagagggaacttagcagagagcaagtgctatttgataacagttactccggtatat
gctgacggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcc
tctttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtggg
aaggatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagcc
atagtcgtgcctgtttgcttagcgttcctattgacaactcttctgggagtgctgttctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacactcctccaaggcacaactttaattcaaaagat
caaatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgac
aaaaaaccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaat
actgaaggacacagcagtggtattgggggttcttcatgcatgtcatcttctaggccaagc
atttctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattct
actgtggtgcacagtggctacagacaccaagttccatccgtgcaagtcttctcaagatcc
gagtctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagat
catgtagatggcagtgatgacattttgcccaggcaacagtacttcaaacagaactgcagt
cagcatgaatccagtcccgatatttcacattttgaaaggtcaaagcaagtttcatcagtc
aatgaggaagattttgttagaattaaacaacagatttcagatcatatttcacaatcctgt
ggatctggggaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggt
actgagggacaagtagaaagatttgaaacaattgggatggaggctgcgattgatgaagga
atgcctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680608
Entry
104680608         CDS       T03989                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X2
  KO
K05063  interleukin 12 receptor beta-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680608 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104680608 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104680608 (IL12RB1)
   04659 Th17 cell differentiation
    104680608 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680608 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104680608 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104680608 (IL12RB1)
   04090 CD molecules [BR:rro04090]
    104680608 (IL12RB1)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL6/12 receptor family
   104680608 (IL12RB1)
CD molecules [BR:rro04090]
 Proteins
  104680608 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N DUF5033
Other DBs
NCBI-GeneID: 104680608
NCBI-ProteinID: XP_010384932
LinkDB
Position
8
AA seq 681 aa
MCSGARDRVAEPRRWWRGSPGAVGLCVDPMGPLVTWVVPLLLLFLRSRQGAACRTSECCF
QDPPYPDADSGSASGPRDLSCYRISSAGYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAA
GSATRLQFSDQAGVSVLHTVTLWVESWARNQTEKSPEVTLQLYKSVKYEPPLGDIKVSKL
AGQLRMEWETPDNQVGAEVQFRHRTPSSSWKLGDCGPQDDDTESCLCPLEMNVAQEFQLR
RRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGRDGRRRLTLKEQPTQLELPEGC
QGPAHGAEVTYQLQLHMLSCPCKAKATRTLPLEKMPYLSGAAYNVAVISSNRFGPGPNQT
WHIPADTHTETVALNISIGTNGTTVYWPARSQSTTYCIEWQPVGQDGSLATCNLTAPQDP
DPAGMATYSWSRESGAMGQEKCYHITIFASAHPKKLTLWSTVLSTYHFGGNASAAGTPHH
VSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCQDEDSNQVSEHPVQPRETQVTLSGLR
AGVAYTVQVRADTAWLRGAWSQPQRFSIKVQVSDWFIFFASLGSFLSILLVGVLGYLGLN
RATRHLCPPLPTPCASSAIQFPAGKETWQWINPVDFQEEASLQEALVVEMSWDKGKRTEP
LEKTQLPEGAPELALDTQLSL
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgtgttccggagcgagggacagggtggctgaacctcgcaggtggtggagaggctcccct
ggggctgtggggctctgcgtggatccaatggggccgctggtgacgtgggtggtccccctc
ctcctcctcttcctgcggtccaggcagggtgctgcctgcagaaccagtgagtgctgtttt
caggacccaccatatccggatgcagactcaggctcagcctcgggccctagggacctgagc
tgctatcggatatccagtgctggttacgagtgttcctggcagtatgagggtcccacagct
ggggtcagccacttcctgcggtgctgccttagctccgggcgctgttgctacttcgccgca
ggctcagccaccaggctgcagttctccgaccaggccggggtgtctgtgctgcacactgtc
acactctgggtggaatcctgggccaggaaccagacagagaagtctcctgaggtgaccctg
cagctctacaagtcagttaaatatgagcctcctctgggagacatcaaggtgtccaagttg
gctgggcagctgcgtatggagtgggagactccggataaccaggttggtgctgaggtgcag
ttccggcaccggacgcccagcagctcatggaagttgggtgactgcggacctcaggatgat
gatactgagtcctgcctctgtcccctggagatgaatgtggcccaggaattccagctccga
cgacggcggctggggagccaggggagttcctggagcaagtggagcagccctgtgtgtgtt
ccccctgaaaaccccccacagcctcaggtgagattctcagtggagcagctgggccgggat
gggaggaggcggctgaccctgaaagagcagccaacccagctggagcttccagaaggctgt
caagggccagcgcatggagcggaggtcacctaccaactgcagctccacatgctgtcctgc
ccgtgtaaggccaaggccaccaggaccttgcccctggagaaaatgccctatctctcgggt
gctgcctacaacgtggctgtcatctcctcgaaccgattcggtcctggcccaaaccagacg
tggcacattcctgctgacacccacacagaaacagtggctctgaatatcagcatcggaacc
aacggaaccactgtgtattggccagcccggtctcagagcacgacgtactgcattgaatgg
cagcccgtgggccaggacggaagccttgccacctgcaacctgacggcgcctcaagaccca
gatccggctggaatggcaacctacagctggagtcgagagtctggggcaatggggcaggaa
aagtgttatcacattaccatctttgcctctgcgcacccaaagaagctcaccttgtggtct
acggtcctgtccacctaccactttgggggcaatgcctcagcagctgggacaccgcaccat
gtctcagtgaagaatcatagcttggactcagtgtctgtggattgggcaccatccctgctg
agcacctgtcccggcgtcctaaaggagtatgttgtccgctgccaagatgaagacagcaac
caggtgtcagagcatcccgtgcagcccagagagacccaagtaaccctcagtggcctgcgg
gctggtgtagcctacacagtgcaggtgcgagcagacacggcgtggctgaggggtgcctgg
agccagccccagcgcttcagcatcaaagtgcaggtttctgattggttcatcttcttcgcc
tccctggggagcttcctgagcatccttctcgtgggcgtccttggctaccttggcctgaac
agggccacacggcacctgtgcccgccgctgcccacaccttgtgccagctccgccattcag
ttccctgcagggaaggagacttggcagtggatcaacccagtggacttccaggaagaggca
tccctgcaggaggctctggtggtggagatgtcctgggacaaaggcaagaggactgagcct
cttgagaagacacagctacctgagggtgcccctgagctggccctcgatacacagctgtcc
ttgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682491
Entry
104682491         CDS       T03989                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta isoform X3
  KO
K04738  cytokine receptor common subunit beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04210  Apoptosis
rro04630  JAK-STAT signaling pathway
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104682491 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104682491 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104682491 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682491 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104682491 (CSF2RB)
   04090 CD molecules [BR:rro04090]
    104682491 (CSF2RB)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL3 receptor family
   104682491 (CSF2RB)
CD molecules [BR:rro04090]
 Proteins
  104682491 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Tissue_fac IL4Ra_N EpoR_lig-bind IL2RB_N1 Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 104682491
NCBI-ProteinID: XP_010387481
LinkDB
Position
13
AA seq 898 aa
MALAQRLLSMALLALCWGRRLAGAEETIPLWTLRCYNDYTSHITCRWADTQDAQQLVNVT
LIRRVNDRDLPEPVSCDLSEDMPWSACPYPRCMPRRCIIPYQNFVVTDVDYYSFQPDRPL
GTQLTVTLTQHVQPPAPKDLWISTDQDHFLLTWSVAPGRPQSHWLSLRDLEFEVVYKRLQ
DSWEDAATLLSNTSQATLGPEHLMPSSTYVARVRARLASGSRLSGRPSEWSPEVRWDSQP
GDEAQPQNLQCFFDGAAVLSCSWEVRQEVTSSVSFGLFYKPSPDAREEECSPVLREGLGS
LYTRHHCQIPVPDPGTHSQYIVSVQPRRAEKRIKSSENIQMAPPSLNVTRDGDSYSLRWE
TMKMQYEHIDHTFEIQYMKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRT
GYNGIWSDWSEVCSWDTESVLPMWVLALVVIFLTIAVLLTLRFCGIYGYRLRRKWEERIP
NPSKSYLFQNGSSELWTPGSMLAFTSGSPPHQGPWDSQFPELEGVFPVGFGDSEVSPLTI
EDLRHVCDPPSGPDATPAASDLPTEQPPSPQPGPPASSHTPEKQVSSFDFNGPYLGPPHS
RSLPDILGQPEPPQACGTQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGHGQAMDVERRPS
QEAAGSSSLESRGDTAPPALGPRVGGQGPKDSPVAVPASSGVPEDPGVASGYVSSADLVF
PPHSGASAVSLVPSLGIPSDQTPSFCPGLASGPPGAPGPVKSGFEGYVELPPTEGQSPRS
PVNNLVPPEVRSPVLNPGERRADVSPTSPQPEGLLVLQQVGDYCFLPGLSPGPLSPRSKP
SSPGPCPEIRDLDQAFQVKKPPGQAVPQVPVIQLFKVLKQQDYLSLPPWEVNKPGEVC
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggcactggcccagaggctgctctccatggccctgctggccctgtgctgggggcgcaga
ctggcaggggcagaagagaccatcccgctgtggaccctgcgctgctacaatgactacacc
agccacatcacctgcaggtgggcggacacccaggatgcccagcagcttgtcaacgtgacc
ctcattcgccgggtgaatgacagggaccttccagagccagtgtcctgtgacctcagtgaa
gacatgccctggtcagcctgcccctatccccgctgcatgcccaggagatgtatcattcct
taccagaattttgtcgtcacggacgttgactactactcattccaaccagacaggcctctg
ggcacccagctcaccgtcactctgacccagcatgtccagcctcctgcgcccaaggacctg
tggatcagcaccgaccaggaccacttcctgctgacctggagtgtggcccctgggaggccc
cagagccactggttgtccctgcgggatctggagtttgaggtggtctacaagcggctccag
gactcttgggaggatgcagccaccctcctctccaacacctcccaggccaccctggggcca
gagcacctcatgcccagcagcacctatgtagcccgagtgcgggcccgcctggcctcaggc
tctcggctctccggacgtcccagcgagtggagcccagaggttcgctgggactcccagcca
ggggacgaggcccagccccagaacctgcagtgcttctttgacggggccgccgtgctcagc
tgctcctgggaggtgaggcaggaagtgaccagctcagtctcctttggcctcttctacaag
cccagcccagatgcaagggaggaagagtgctccccagtgctgagggaggggctcggcagc
ctctacaccaggcaccactgccagattcccgtgcccgaccctgggacccacagccaatac
atcgtctccgttcagccaaggagggcagagaaacgcataaagagctcagaaaacatccag
atggcccctccatccctcaacgtgaccagggatggagacagctacagtctgcgctgggaa
acaatgaaaatgcaatatgaacacatagaccacacatttgagatccagtacatgaaagac
acggccacgtggaaggacagcaagaccgagaccctccagaacgcccacagcatggccctg
ccagccctggagccctccaccagatactgggccagggtgagggtcaggacctcccgcacc
ggctacaatggaatctggagcgactggagtgaggtgtgctcctgggacaccgagtctgtg
ctgcccatgtgggtgctggctctggtcgtgatcttcctcaccatcgctgtgctcctgacc
ctccgcttctgtggcatctacgggtacaggctgcgtagaaagtgggaggagaggatcccc
aaccccagcaagagctacctgttccagaacgggagctcagagctttggaccccaggcagc
atgttggccttcaccagcgggagccccccacaccaggggccgtgggacagccagttccct
gagctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccata
gaggacctcaggcatgtctgtgatccaccatctgggcctgacgcgactccagctgcctca
gatctgcccacagagcagccccccagcccccagccaggcccgcctgcctcctcccacacg
cctgagaagcaggtttccagctttgacttcaatgggccctacctggggccgccccacagc
cgctccctgcctgacatcctgggccagccagagcccccacaggcgtgtgggacccagaag
tccccacctccagggtccctggagtacctgtgtctgcctgctggggggcaggtgcagctg
gtccctctggcccaggcgatgggacatggccaggccatggacgtggagaggaggccgagc
caggaggctgcagggagttcctccctggagtccaggggagacactgcccctcctgctctt
gggccaagggtgggaggacagggcccaaaggacagccctgtggctgtacccgcaagctct
ggggttcctgaggaccctggagtggcctctggttacgtctcctctgcagacctggtattc
cccccacactcaggggcctcggcggtctccctggttccctctctgggcatcccctcagac
cagacccccagcttctgtcctgggctggccagtggaccccctggagccccaggccctgtg
aagtcagggtttgagggctatgtggagctccctccaactgagggccagtcccccaggtcc
ccagtgaacaatcttgtcccccctgaggtcagaagccctgtcctgaatccaggggaacgc
cgggcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaggtg
ggcgactattgcttcctcccaggcctgagccctggccctctctcaccacggagtaaaccc
tcttccccgggaccctgtcctgagatcagggatctagaccaggcttttcaagtcaagaag
cccccaggccaggctgtgccccaggtgcccgtcattcaacttttcaaagtcctgaagcag
caggactacctgtctctgcccccttgggaggtcaacaagcctggggaggtgtgttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682498
Entry
104682498         CDS       T03989                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X2
  KO
K05069  interleukin 2 receptor beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104682498 (IL2RB)
   04151 PI3K-Akt signaling pathway
    104682498 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104682498 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104682498 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104682498 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104682498 (IL2RB)
   04659 Th17 cell differentiation
    104682498 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682498 (IL2RB)
   05202 Transcriptional misregulation in cancer
    104682498 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104682498 (IL2RB)
   05162 Measles
    104682498 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rro04050]
    104682498 (IL2RB)
   04090 CD molecules [BR:rro04090]
    104682498 (IL2RB)
Cytokine receptors [BR:rro04050]
 Interleukin receptor families
  IL2 receptor family
   104682498 (IL2RB)
CD molecules [BR:rro04090]
 Proteins
  104682498 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 104682498
NCBI-ProteinID: XP_010387495
UniProt: A0A2K6RLB3
LinkDB
Position
13
AA seq 551 aa
MATLALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSKANISCVWSQDGALQDTSCQ
VHAWPDRRWWNQTCELLPVSQASWACNLILGDPNSQKLTAVDIVTLRVMCREGVRWRMMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISEASHYFERHLEFEARTLSPGHTWEE
APLMTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHFLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCHTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPSSLSSNRSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYAEEEPDEGGAGTPTGSSPQPLWPLSAEDDAYCT
FPSGDDLLLFSPSLLGGPSPPSTAPGGSGAGEERLPASLQERVPRDWDPQPLGPPTPGVP
DLVDFQPFPELVLREAGEEVPDPGPREPFGFPWVRPPGQGEVRALNARLPLNTDAYLSLQ
ELQDQDPTHLV
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggcgacccttgctctgtcctggcgtctgcccctcctcatcctcctcctgcctctggct
acctcttgggcatctgcagcggtgaacggcacttcccagttcacatgcttctacaactcg
aaagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggtggtggaaccaaacctgtgaactgctccctgtgagt
caagcatcctgggcctgcaacctgatacttggagacccaaattctcagaaactgaccgca
gtggacatcgtcaccctgagggtgatgtgccgtgaaggggtgcgatggaggatgatggcc
atccaggacttcaaaccctttgagaaccttcgcctgatggctcccatctccctccaagtc
gtccacgtggagacccaccgatgcaacataagctgggaaatctccgaagcctcccactac
tttgaaagacacctggagtttgaggcccggacgctgtccccaggccacacctgggaggag
gcccccttgatgaccctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacttcctcgtgggcctcagcggggcctttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
cacaccccagacccttcgaagttcttttcccagctgagctcagagcatggaggagatgtc
cagaaatggctctcctcgcccttcccctcatcgtccttcagccctggtggcctggcgcct
gagatctcaccactggaagtgctggagagggacaaggtgacacagctgctcctgcagcag
gacaaggtgcctgagccctcatccttaagcagcaaccgctcactgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttatgatccctacgcagaggaagagcctgatgagggtggggccggcacgccc
acagggtcttccccccaacccctgtggcctctgtcagcggaggacgacgcctactgcacc
ttcccctccggggatgacctgctgctcttctcccccagtctccttggtggccccagcccc
ccaagcactgcccctgggggcagcggggctggtgaagagaggctacccgcttccctgcag
gagagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccattccctgagctggtgctgcgagaggctggggaggaggtc
cctgaccctggccccagggagccgtttggattcccctgggtgaggcctcctgggcagggg
gaggtcagggctcttaatgctcgcctgcccctgaacactgatgcttacttgtccctccaa
gaactccaggatcaggacccaactcacttggtgtag

DBGET integrated database retrieval system