KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656155
Entry
104656155         CDS       T03989                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro04114  Oocyte meiosis
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05161  Hepatitis B
rro05162  Measles
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05206  MicroRNAs in cancer
rro05215  Prostate cancer
rro05222  Small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104656155 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104656155 (CCNE1)
   04114 Oocyte meiosis
    104656155 (CCNE1)
   04115 p53 signaling pathway
    104656155 (CCNE1)
   04218 Cellular senescence
    104656155 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656155 (CCNE1)
   05206 MicroRNAs in cancer
    104656155 (CCNE1)
   05203 Viral carcinogenesis
    104656155 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    104656155 (CCNE1)
   05215 Prostate cancer
    104656155 (CCNE1)
   05222 Small cell lung cancer
    104656155 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104656155 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104656155 (CCNE1)
   05161 Hepatitis B
    104656155 (CCNE1)
   05162 Measles
    104656155 (CCNE1)
   05169 Epstein-Barr virus infection
    104656155 (CCNE1)
   05165 Human papillomavirus infection
    104656155 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rro03032]
    104656155 (CCNE1)
   03036 Chromosome and associated proteins [BR:rro03036]
    104656155 (CCNE1)
DNA replication proteins [BR:rro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104656155 (CCNE1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104656155 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104656155
NCBI-ProteinID: XP_030769618
LinkDB
Position
12
AA seq 410 aa
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVAVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNTVCADPCSLIPTPDKEDDERVYPNSSCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAVLSEQNRASPLPSGLLTPPQSSKKQSSEPEMA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggt
ggcgcagagttctcggctcgctccaggaagaggaaggcaaacgtggccgtttttttgcag
gatccagatgaagaaatggccaaaatcgataggacggcgagggaccagtgtgggagccag
ccttgggacaataatacagtctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgagcgggtttacccaaactcatcgtgcaagcctcggattattgcaccatcc
agaggctccccactgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagggagaccttttacttggcacaggatttctttgaccggtatatggcgacacag
gaaaatgttgtaaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcatatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgctggatctctgtgtcctggatgttgactgcctcgaatttccttatggtatacttgct
gcttcagccttgtatcatttctcttcatctgaattgatgcaaaaggtttcaggatatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
acggggagctcaaaactgaagcacttcaggggcgttgctgatgaagatgcacacaacata
cagacccacagagacagcttggatttgctggacaaagcccgagcaaagaaagccgtgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcacccctccacagagcagt
aagaagcagagcagcgagccagaaatggcgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660331
Entry
104660331         CDS       T03989                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X2
  KO
K06626  G1/S-specific cyclin-E1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro04114  Oocyte meiosis
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05161  Hepatitis B
rro05162  Measles
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05206  MicroRNAs in cancer
rro05215  Prostate cancer
rro05222  Small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104660331 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104660331 (CCNE2)
   04114 Oocyte meiosis
    104660331 (CCNE2)
   04115 p53 signaling pathway
    104660331 (CCNE2)
   04218 Cellular senescence
    104660331 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660331 (CCNE2)
   05206 MicroRNAs in cancer
    104660331 (CCNE2)
   05203 Viral carcinogenesis
    104660331 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    104660331 (CCNE2)
   05215 Prostate cancer
    104660331 (CCNE2)
   05222 Small cell lung cancer
    104660331 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104660331 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104660331 (CCNE2)
   05161 Hepatitis B
    104660331 (CCNE2)
   05162 Measles
    104660331 (CCNE2)
   05169 Epstein-Barr virus infection
    104660331 (CCNE2)
   05165 Human papillomavirus infection
    104660331 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rro03032]
    104660331 (CCNE2)
   03036 Chromosome and associated proteins [BR:rro03036]
    104660331 (CCNE2)
DNA replication proteins [BR:rro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104660331 (CCNE2)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104660331 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104660331
NCBI-ProteinID: XP_010358945
UniProt: A0A2K6PMN8
LinkDB
Position
9
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTESPQEVQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHEKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLSLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYIHTFSKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagcctcagcccagccagacggaa
tcaccccaagaagtccagataatccaggccaagaagaggaaaaccacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctgggggaatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgaaaaacattttgaagttctgcattctgacttggaaccacag
atgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcacagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttgaaatgggaactttgtcct
gtaacaatcatctcctggctaagtctctttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcaatattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactgactgctgctgcc
ttgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaaattatttggccatgctggaagaagtaaattacatacacaccttcagcaaaggggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcaccgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system