KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656307
Entry
104656307         CDS       T03989                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04064  NF-kappa B signaling pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104656307 (GADD45G)
   04064 NF-kappa B signaling pathway
    104656307 (GADD45G)
   04068 FoxO signaling pathway
    104656307 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104656307 (GADD45G)
   04210 Apoptosis
    104656307 (GADD45G)
   04115 p53 signaling pathway
    104656307 (GADD45G)
   04218 Cellular senescence
    104656307 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656307 (GADD45G)
   05202 Transcriptional misregulation in cancer
    104656307 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104656307 (GADD45G)
   05212 Pancreatic cancer
    104656307 (GADD45G)
   05225 Hepatocellular carcinoma
    104656307 (GADD45G)
   05226 Gastric cancer
    104656307 (GADD45G)
   05214 Glioma
    104656307 (GADD45G)
   05216 Thyroid cancer
    104656307 (GADD45G)
   05220 Chronic myeloid leukemia
    104656307 (GADD45G)
   05217 Basal cell carcinoma
    104656307 (GADD45G)
   05218 Melanoma
    104656307 (GADD45G)
   05213 Endometrial cancer
    104656307 (GADD45G)
   05224 Breast cancer
    104656307 (GADD45G)
   05222 Small cell lung cancer
    104656307 (GADD45G)
   05223 Non-small cell lung cancer
    104656307 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    104656307 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104656307 (GADD45G)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104656307 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104656307 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104656307
NCBI-ProteinID: XP_010354212
UniProt: A0A2K6QPC4
LinkDB
Position
16
AA seq 159 aa
MTLEEVRGQDTVPESTDRMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccagaaagcacagacaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtccgcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgc
gtgctggctgccgatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggcgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcctgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657306
Entry
104657306         CDS       T03989                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04064  NF-kappa B signaling pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104657306 (GADD45A)
   04064 NF-kappa B signaling pathway
    104657306 (GADD45A)
   04068 FoxO signaling pathway
    104657306 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104657306 (GADD45A)
   04210 Apoptosis
    104657306 (GADD45A)
   04115 p53 signaling pathway
    104657306 (GADD45A)
   04218 Cellular senescence
    104657306 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657306 (GADD45A)
   05202 Transcriptional misregulation in cancer
    104657306 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104657306 (GADD45A)
   05212 Pancreatic cancer
    104657306 (GADD45A)
   05225 Hepatocellular carcinoma
    104657306 (GADD45A)
   05226 Gastric cancer
    104657306 (GADD45A)
   05214 Glioma
    104657306 (GADD45A)
   05216 Thyroid cancer
    104657306 (GADD45A)
   05220 Chronic myeloid leukemia
    104657306 (GADD45A)
   05217 Basal cell carcinoma
    104657306 (GADD45A)
   05218 Melanoma
    104657306 (GADD45A)
   05213 Endometrial cancer
    104657306 (GADD45A)
   05224 Breast cancer
    104657306 (GADD45A)
   05222 Small cell lung cancer
    104657306 (GADD45A)
   05223 Non-small cell lung cancer
    104657306 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    104657306 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104657306 (GADD45A)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104657306 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104657306 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104657306
NCBI-ProteinID: XP_010355372
UniProt: A0A2K6PK30
LinkDB
Position
12
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcggacgatcactgtcggggtg
tacgaagcggccaaactgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgagcgagggcgcggagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaactaatttgtttttgccgggaaagtcgctacatggatcagtgggttccggtgatt
aatctccctgaacggtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671382
Entry
104671382         CDS       T03989                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04064  NF-kappa B signaling pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104671382 (GADD45B)
   04064 NF-kappa B signaling pathway
    104671382 (GADD45B)
   04068 FoxO signaling pathway
    104671382 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104671382 (GADD45B)
   04210 Apoptosis
    104671382 (GADD45B)
   04115 p53 signaling pathway
    104671382 (GADD45B)
   04218 Cellular senescence
    104671382 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671382 (GADD45B)
   05202 Transcriptional misregulation in cancer
    104671382 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104671382 (GADD45B)
   05212 Pancreatic cancer
    104671382 (GADD45B)
   05225 Hepatocellular carcinoma
    104671382 (GADD45B)
   05226 Gastric cancer
    104671382 (GADD45B)
   05214 Glioma
    104671382 (GADD45B)
   05216 Thyroid cancer
    104671382 (GADD45B)
   05220 Chronic myeloid leukemia
    104671382 (GADD45B)
   05217 Basal cell carcinoma
    104671382 (GADD45B)
   05218 Melanoma
    104671382 (GADD45B)
   05213 Endometrial cancer
    104671382 (GADD45B)
   05224 Breast cancer
    104671382 (GADD45B)
   05222 Small cell lung cancer
    104671382 (GADD45B)
   05223 Non-small cell lung cancer
    104671382 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    104671382 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104671382 (GADD45B)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104671382 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104671382 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104671382
NCBI-ProteinID: XP_010373148
UniProt: A0A2K6R6K7
LinkDB
Position
8
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIMRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagctgctggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggcaaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacattgccctgcaaatccacttcacgctcatccagtcc
ttctgctgcgacaacgacattaacatcatgcgggtgtcgggcatgcagcgcctggcacag
ctcctgggagagccggccgagactcagggcaccactgaggcccgagacctgcattgtctt
ctggtcacgaaccctcacacagacgcctggaagagccacggcttggtggaggtagccagc
tactgcgaagaaagccggggcaacaaccagtgggtgccctacatctctcttcaggaacgc
tga

DBGET integrated database retrieval system