KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656323
Entry
104656323         CDS       T03989                                 

Gene name
NKX3-2
Definition
(RefSeq) homeobox protein Nkx-3.2
  KO
K09995  homeobox protein Nkx-3.2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104656323 (NKX3-2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104656323 (NKX3-2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 104656323
NCBI-ProteinID: XP_010354222
UniProt: A0A2K6PHV4
LinkDB
Position
2
AA seq 333 aa
MAVRSANTLTPFSIQAILNKKEERGGLAAPEGRPASGGTAVSVAAAPAVCCWRLFGERDA
GALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCPDAPGASGAGLAG
GSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHMSALCSG
AGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLA
ASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLR
PPSLLPLQPSYYYPYYCLPGWALSTCTAAAGTQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggctgtgcgcagcgccaacaccttgacgcccttctccatccaggcgatcctcaacaaa
aaagaggagcgcggcgggctggccgcgccagaggggcgcccggcgtccgggggcacagcg
gtgtcggtggccgcggcgcccgctgtctgctgttggcggctctttggggagagggacgcg
ggcgcgctggggggcgccgaggactctctgctggcgtctcctgccggtaccagaacagct
gcggggcggactgcggagagcccggaaggctgggactcggactccgcgctcagcgaggag
aacgagagcaggcggcgctgccctgacgcgccaggggccagcggggccggcctcgcgggg
ggatccttgagcctcggccagccagtctgtgagttggccgcttccaaagacctagaggag
gaagccgcgggccggagcgacagcgagatgtccgccagcgtctcaggcgaccgcagccca
aggaccgaggacgacggtgttggccccagaggtgcacacatgtccgcgctgtgcagcggg
gccggcggcgggggcggcagcgggccggcaggcgtcgcggaggaggaggaggagccggcg
gcgcccaagccacgcaagaagaggtcgcgggccgccttctcccacgcgcaggtcttcgag
ctggagcgccgctttaaccaccagcgctacctgtccgggcccgagcgcgccgacctggcc
gcgtcgctgaagctcaccgagacgcaggtgaaaatctggttccagaaccgtcgctacaag
accaagcgccggcagatggccgccgacctgctggcctcggcgcccgccgccaagaaggtg
gcggtaaaggtgctggtgcgcgacgaccagagacaatacctgcccggcgaagtgctgcgg
ccaccctcgcttctgccactgcagccctcctactattacccctactactgcctcccaggc
tgggcgctctccacctgcacggctgccgcagggacccagtga

DBGET integrated database retrieval system