KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656342
Entry
104656342         CDS       T03989                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05134  Legionellosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05164  Influenza A
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104656342 (APAF1)
   04215 Apoptosis - multiple species
    104656342 (APAF1)
   04115 p53 signaling pathway
    104656342 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656342 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104656342 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104656342 (APAF1)
   05012 Parkinson disease
    104656342 (APAF1)
   05014 Amyotrophic lateral sclerosis
    104656342 (APAF1)
   05016 Huntington disease
    104656342 (APAF1)
   05020 Prion disease
    104656342 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    104656342 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    104656342 (APAF1)
   05152 Tuberculosis
    104656342 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104656342 (APAF1)
   05160 Hepatitis C
    104656342 (APAF1)
   05164 Influenza A
    104656342 (APAF1)
   05162 Measles
    104656342 (APAF1)
   05168 Herpes simplex virus 1 infection
    104656342 (APAF1)
   05169 Epstein-Barr virus infection
    104656342 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104656342 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like eIF2A CARD_2 AAA_16 Utp8 Nbas_N AAA_22 Cactin_mid NACHT
Other DBs
NCBI-GeneID: 104656342
NCBI-ProteinID: XP_010354239
UniProt: A0A2K6PZZ4
LinkDB
Position
10
AA seq 1248 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYISFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEDCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKYYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNAVTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
NDCFLKLWDLNQKECRNTMFGHTDSVNHCRFSPDDKLLASCSADGTLKLWDVTSANERKS
FNVKQFFLNSEDPQEDMEVIVKCCSWFADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNIDSCSKVADCRGHLSWVHGVKFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAIMLKQEVDVVFQENEVMVLAVDHIRRLQLINGKTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGTIEILELVNNRIFQSRIRHKKTVWHIQFTADEKTLIS
SSDDSAIQVWNWQLEEYVFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGKIEKD
FVCHQGTVLSCDISHDTTKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggacatc
aagacatcctacatcatggatcatatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctaattaaaatgata
cttaaaaaagataatgattcctacatatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttagtggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtacca
cagaggccagttgtttttgtcacaaggaagaagctggtgaatgcaattcagcagaagctc
tccaaattgaagggtgaaccaggatgggtcaccatacatggaatggcaggctgtggaaag
tctgtattggctgcagaagctgttagagatcattccctcttagaagattgtttcccaggg
ggagtgcattgggtttcagttgggaaacaagacaaatccggacttctgatgaaactgcag
aatctttgcacacgattggatcaagatgagagtttttcccagaggcttccacttaatatt
gaagaggctaaagaccgtcttcgcattctgatgcttcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggactcttgggtgttgaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgtagtc
cctgtggagagttccttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcaaacaacttcagaataagcagtttaagagaataaggaaatcttcgtcttatgat
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
tattattacacagatctttccatccttcagaaggacgttaaggtgcctacaaaggtgtta
tgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtaaat
aagtctcttttattttgtgatcggaatggaaagtcgtttcgttattatttacatgatctt
caagtagattttcttacagagaagaattgcagccagcttcaggatctacataaaaagata
atcactcagtttcagagatatcaccagccgcatactctttcaccagatcaggaagactgt
atgtattggtacaactttctggcctatcacatggccagtgccaagatgcacaaggaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacagacatatactagatgaaaaggattgtgcagtc
agtgagaattttcaggagtttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacaactgggtctctgtgagccggaaacttcagaagtttatcagcaagct
aagctgcaggccaagcaggaggtcgataatggaatgctttacctggaatggataaacaaa
aaaaacatcacgaatctttcccgcttagttgtccgcccccacacagatgctgtttaccat
gcctgcttttctgaggatggtcagagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttttagaaatcaaggctcatgaggacgaagtg
ctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaatgctgtgaccggggaactagtacacacctatgatgagcactcagag
caagtcaattgctgccatttcaccaacagtagtcatcatcttctcttagccactgggtca
aatgactgcttcctcaaactctgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggtcatacagattcagttaatcactgcagattttcaccagatgataagcttttggctagt
tgctcagctgatggaaccttaaagctttgggatgtgacatcagcaaacgagaggaaaagc
tttaatgtgaaacagttcttcctaaattcagaggaccctcaagaggatatggaagtgata
gtgaagtgttgttcgtggtttgctgatggtgcaaggataatggtggcagcaaaaaataaa
atctttctttttgatattcataccagtggcctattgggagaaatccacacgggccatcac
agcaccatccagtactgtgacttctccccgcaaaaccatttggcagtggttgctttgtcc
cagtactgtgtagagttgtggaatatagactcatgttcaaaggtggctgattgcagagga
catttaagttgggttcatggtgtgaagttttctcctgatggatcatcatttttgacatct
tctgatgaccagacaattaggctctgggagacaaagaaagtatgtaagaactctgctata
atgttaaagcaagaagtagatgttgtgtttcaagaaaatgaagtgatggtccttgcagtt
gaccatataagacgtctgcaactcattaatggaaaaacaggtcagattgattatctgact
gaagctcaagttagctgctgttgcttaagtccgcatcttcaatacattgcatttggagac
gaaaatggaaccattgagattttagaacttgtaaacaatagaatcttccaatccaggatt
cggcacaagaaaactgtatggcacatccagttcacagccgatgagaagacacttatttca
agttctgatgattctgcaattcaggtatggaattggcagttggaggaatatgtctttcta
caagcccatcaggaaacagtgaaagactttagactcttgaaaaattcaagactgctttct
tggtcatttgatggaacagtgaaggtatggaatataattactggaaaaatagaaaaagac
tttgtctgtcaccagggtacagtactttcttgtgacatttctcatgatactaccaagttt
tcgtctacctctgctgacaagactgcaaagatctggagttttgatctccttttgccactt
catgaattgaggggccacaacggctgtgtgcgctgctctgccttctctgtggacagtacc
ctgctggcaacgggagatgacaatggagaaatcaggatatggaatgtctcaaacggtgag
cttcttcacttgtgtgctccgctttcagaagaaggagctgctacccatggaggctgggtg
actgacctttgcttttctccagatggcaaaatgcttatctctgctggaggatatattaag
tggtggaacgttgtcactggggaatcctcacagaccttctacacaaatggaaccaatctt
aagaaaatacatgtgtcccctgacttcaaaacatatgtgactgtggataatcttggtatt
ttatatattttacagactttagaataa

DBGET integrated database retrieval system