KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656474
Entry
104656474         CDS       T03989                                 

Gene name
PKD2L1
Definition
(RefSeq) polycystic kidney disease 2-like 1 protein isoform X1
  KO
K04990  polycystin 2L1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104656474 (PKD2L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104656474 (PKD2L1)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   104656474 (PKD2L1)
SSDB
Motif
Pfam: PKD_channel Ion_trans Fer4_24
Other DBs
NCBI-GeneID: 104656474
NCBI-ProteinID: XP_010354394
LinkDB
Position
11
AA seq 788 aa
MNAVEIPEGQELQKLGSGAWDNPAYSGPPSPHGTLKVCTISSTGPLQPQPKKPEDEPQER
AHRTQVSSCCLHICRGIRGLWGTTLTENTAENRELYVKTTLRELLVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTASDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPL
NGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPGSRQGSAEALRDLQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVVFC
VFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEQ
MRQDLEEERVALNTEIEKLGRSVVSTPQGESGPEAAKAGGWVSGEEFYMLTRRVLQLETV
LEGVVSQVDAVGSKLKMLETKGWLVPSPGVEEQAIWKHLQPAPAVTPDPWGIEGGQESKV
PYKRERKP
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgaacgctgtggaaattcctgaggggcaggaactgcaaaagctggggagtggagcctgg
gacaaccccgcctacagtggtcccccttcaccacatgggacgctgaaggtctgcaccatc
tccagcacagggcccctccagccccaacccaagaagcctgaagatgaaccccaggagagg
gcacacaggactcaggtgtccagctgctgcctccatatctgtcgaggcatcagaggactt
tggggaacaaccctgactgagaacacagctgagaaccgggaactttacgtcaagaccacc
ctgcgggagctgttggtatatattgtgttcctggtggacatctgtctattgacctatgga
atgacaagctccagtgcttattactacaccaaagtgatgtctgagctcttcttacatacc
gcatcagacactggagtctcctttcaggccatcagcagcatggcagacttctgggatttt
gcccagggcccactactggacagtttatattggaccaaatggtacaacaaccagagcctg
ggccatggctcccactccttcatctactatgagaacctgctgctgggggttccgaggctg
cggcagctaaaggtccgcaatgactcctgcgtggtgcatgaagacttccgggaggacatt
ctgagctgctatgatgtctactctccagacaaagaagaacaactcccctttgggccgctc
aatggcacagcgtggacataccactcgcaggatgagttggggggctcctcccactggggc
aggctcacaagctacagtggaggtggctactacctggaccttccaggatcccgacagggt
agtgcagaggctctccgggaccttcaggaggggctgtggctggacagaggcactcgggtg
gtgttcatcgacttctcagtctacaatgccaacatcaatcttttctgtgtcctgaggctg
gtggtggagtttccagctacaggaggtgccatcccatcctggcaaatccgcacggtcaag
ctgatccgctatgtcagcaactgggacttctttattgttggctgtgaggtcgtcttctgc
gtcttcatcttctactatgtggtggaagaaatcctggagctccacattcaccggcttcgc
tacctcagcagcatctggaacatactggacttggtggtcatcttgctctccattgtggct
gtgggcttccacatattccgaaccctcgaggtgaatcggctcatggggaagctcctgcag
cagccaaacacatatgcagactttgagttcctcgccttctggcagacacagtacaacaac
atgaatgctgtcaacctcttcttcgcctggatcaagatattcaagtacatcagcttcaac
aaaaccatgacccagctctcctccacgctggcccgctgtgccaaggacatcctgggcttc
gccgtcatgttcttcattgttttcttcgcctatgcccaactcggctacctgcttttcggg
acccaagtggaaaactttagcactttcatcaagtgcattttcactcagttccggataatc
ctcggggactttgactacaatgctattgacaatgccaaccgcatcctgggccctgcctac
tttgtcacctatgtcttcttcgtcttcttcgtgctcctgaacatgttcctggccatcatc
aatgacacatattcagaggtcaaggaggagctggctggacagaaggatgagctgcaactt
tctgacctcctgaaacagggctacaacaagaccctgctaagactgcgtctgaggaaggag
agggtttcggatgtacagaaggtcctgcagggtggggagcaggagatccagtttgaggat
ttcaccaacaccttaagagaactgggacacgcagagcatgaaatcactgagctcacggcc
accttcaccaagtttgacagagatgggaatcgtattctggatgagaaggaacaggaacaa
atgcgacaggacctggaggaagagagggtggccctcaacactgagattgagaaactaggc
cgatccgttgtgagcaccccacaaggcgagtctggtccagaggctgccaaagcaggaggc
tgggtttcaggagaagaattctacatgctcacaaggagagttctgcagctggagactgtg
ctggaaggcgtagtgtcccaggttgatgctgtcggctcaaagttgaaaatgctggagacg
aaggggtggctggttccctccccaggcgtggaggaacaagctatttggaagcacctgcag
ccagccccagctgtgaccccagacccttggggaatcgagggtgggcaggagagtaaggtt
ccctataaaagagagaggaagccttag

DBGET integrated database retrieval system