KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656476
Entry
104656476         CDS       T03989                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104656476 (WNT8B)
   04390 Hippo signaling pathway
    104656476 (WNT8B)
   04150 mTOR signaling pathway
    104656476 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104656476 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104656476 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656476 (WNT8B)
   05205 Proteoglycans in cancer
    104656476 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104656476 (WNT8B)
   05226 Gastric cancer
    104656476 (WNT8B)
   05217 Basal cell carcinoma
    104656476 (WNT8B)
   05224 Breast cancer
    104656476 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104656476 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    104656476 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104656476 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104656476 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104656476 (WNT8B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104656476 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104656476
NCBI-ProteinID: XP_010354397
UniProt: A0A2K6PYK0
LinkDB
Position
11
AA seq 351 aa
MFLSKPSVYISLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtttctttcaaagccttctgtgtacatctctcttttcacctgtgtcctccaactcagc
cacagctggtcagtgaacaatttcctgatgactggtccaaaggcttacctgatttactcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgctggaactgccctgagagagctctgcagctgtccagccatggtgggcttcgcagt
gctaatcgggagacagcatttgtgcatgccatcagttctgctggagtcatgtacaccctg
actagaaactgcagccttggagattttgataactgtggctgtgatgactcccgcaatggg
caactggggggccaaggctggctgtggggaggctgcagcgacaatgtgggcttcggagag
gcgatttccaagcagtttgtcgatgccctggaaacaggacaggatgcacgggcagccatg
aacctgcacaacaacgaggctggccgcaaggcggtgaagggcaccatgaaacgtacgtgc
aagtgccacggcgtgtctggcagctgcaccacgcagacctgttggctgcagctgcccgag
ttccgcgaggtgggcgcgcacctgaaggagaagtaccacgcagcactcaaggtagacctg
ctgcagggtgctggcaacagcgctgccggccgcggcgccatcgccgacacctttcgctcc
atctccacccgggagctggtgcacctggaggactccccggactactgcctggagaacaaa
acgctaggactgctgggcaccgaaggccgagagtgcctgaggcgcgggcgggccctgggt
cgctgggaacgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggag
cgccgggccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgcagtccgc
tgcgagcagtgccgccggcgggtcaccaagtacttctgcagccgcgcagagcggccgcgg
gggggcgctgcgcacaaacccgggagaaaaccctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658925
Entry
104658925         CDS       T03989                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104658925 (WNT2B)
   04390 Hippo signaling pathway
    104658925 (WNT2B)
   04150 mTOR signaling pathway
    104658925 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104658925 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104658925 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658925 (WNT2B)
   05205 Proteoglycans in cancer
    104658925 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104658925 (WNT2B)
   05226 Gastric cancer
    104658925 (WNT2B)
   05217 Basal cell carcinoma
    104658925 (WNT2B)
   05224 Breast cancer
    104658925 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104658925 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    104658925 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104658925 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104658925 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104658925 (WNT2B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104658925 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104658925
NCBI-ProteinID: XP_010357366
UniProt: A0A2K6PN62
LinkDB
Position
8
AA seq 391 aa
MLRPGGAEEAAQLPLRRARAPVPVPSPAVPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgcccgcgcc
ccggtccctgtgccctcgcctgcggtccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgagaagcagct
tttgtatatgccatctcatcagcaggggtagtccatgctattactcgtgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccattatggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcgctctcagatttccgccgc
acaggtgattacctgcggcggcgctatgatggggctgtgcaggtgatggccacgcaggat
ggtgccaatttcaccgcagcccgccaaggctatcgccgtgccacccgaactgatcttgtc
tactttgacaactccccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggtcgagggtatgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggatgtccatacttgcaag
gcccccaagaaggcagagtggctggaccagacctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660036
Entry
104660036         CDS       T03989                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104660036 (WNT6)
   04390 Hippo signaling pathway
    104660036 (WNT6)
   04150 mTOR signaling pathway
    104660036 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104660036 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104660036 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660036 (WNT6)
   05205 Proteoglycans in cancer
    104660036 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104660036 (WNT6)
   05226 Gastric cancer
    104660036 (WNT6)
   05217 Basal cell carcinoma
    104660036 (WNT6)
   05224 Breast cancer
    104660036 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104660036 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    104660036 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104660036 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104660036 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104660036 (WNT6)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104660036 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104660036
NCBI-ProteinID: XP_030772493
LinkDB
Position
14
AA seq 365 aa
MLPPAPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPISICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRSPPRPSGLPGTPGPPGPVGSPEGSSAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LNLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcgccctcccgcctcgggctgctgctgctgctgctcctgtgcccagcg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggatcctatcagcatc
tgcaggaaggcacggcggctggccgggaggcaggctgagttgtgccaggctgagccggaa
gtagtggcagagctagcccgaggcgcccggctcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggcctttggacgcatcctgcagcag
gacattcgagagacggccttcgtgttcgccatcactgcggcgggcgccagccacgccgtc
acgcaggcctgttccatgggcgagctgctgcagtgcggctgccaggcgccccgcgggcgg
tcccctccccggccctctggcctgcccggcacccccggaccccctggccccgtgggctcc
ccggaaggcagctctgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgcgcg
ttggtgcaactgcacaacaacgaggcgggccggctggccgtgcggagccacacgcgcacc
gagtgcaaatgccacgggctgtcgggctcgtgcgcgctgcgaacctgctggcagaagctg
cctccatttcgcgaggtgggcgcgcggctgctggagcgcttccacggcgcctcacgcgtc
atgggcactaacgacggcaaggccctactgccagccgtccgcacgctcaagccgccgggc
cgagcggacctcctctacgccgctgattcgcccgacttctgcgcccccaaccgacgcacc
ggctcccccggcacgcgcggccgcgcctgcaacagcagcgccccggacctcagtggttgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgtttccactggtgctgcgtagtgcagtgccaccgctgccgtgtgcgcaaggag
ctcaacctctgcctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660037
Entry
104660037         CDS       T03989                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104660037 (WNT10A)
   04390 Hippo signaling pathway
    104660037 (WNT10A)
   04150 mTOR signaling pathway
    104660037 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104660037 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104660037 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660037 (WNT10A)
   05205 Proteoglycans in cancer
    104660037 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104660037 (WNT10A)
   05226 Gastric cancer
    104660037 (WNT10A)
   05217 Basal cell carcinoma
    104660037 (WNT10A)
   05224 Breast cancer
    104660037 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104660037 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    104660037 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104660037 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104660037 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104660037 (WNT10A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104660037 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 104660037
NCBI-ProteinID: XP_010358561
UniProt: A0A2K6PDT6
LinkDB
Position
14
AA seq 417 aa
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccagccccagccgcggcca
gcgctctgggtgctcctgttcttcctactgctgctggctgctgccatgcccaggtcagca
cccaatgacattctggacctccgcctccccccggagcctgtgctcaatgccaacacagtg
tgcctaacattgccaggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgat
gtggctgcctcagccatacagggcatccagatcgctatccacgaatgccaacaccaattc
agggaccagcgctggaactgctcaagcctggagactcgcaacaagatcccctatgaaagt
cccatcttcagcagaggtttccgagagagcgcttttgcctacgccatcgcggcagctggt
gttgtacacgccgtgtccaatgcgtgtgccctgggcaaactaaaggcctgtggctgcgat
gcctcccggcgaggggacgaggaggccttccgtaggaagctgcaccgcctacaactggac
gcactgcagcgtggtaagggcctgagccatggggtcccggaacacccagccctgcccaca
gccagcccaggcctgcaggactcctgggagtggggcggctgcagccccgacatgggcttc
ggggagcgcttctctaaggactttctggactcccgggagcctcacagagacatccacgca
agaatgaggcttcacaacaaccgagttgggagacaggcagtgatggagaacatgcggcga
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
cccgagttccgcaccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggcccagcgggggcaccctcgccg
gctcccggagctcccgggccgcgccgccgggccagccccgccgacctggtctacttcgaa
aagtcacccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgcgggctcggatggctgcggcagcatgtgttgcggccgcggc
cacaacatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgc
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662531
Entry
104662531         CDS       T03989                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104662531 (WNT5B)
   04390 Hippo signaling pathway
    104662531 (WNT5B)
   04150 mTOR signaling pathway
    104662531 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104662531 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104662531 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    104662531 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662531 (WNT5B)
   05205 Proteoglycans in cancer
    104662531 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104662531 (WNT5B)
   05226 Gastric cancer
    104662531 (WNT5B)
   05217 Basal cell carcinoma
    104662531 (WNT5B)
   05224 Breast cancer
    104662531 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104662531 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    104662531 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104662531 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104662531 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104662531 (WNT5B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104662531 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104662531
NCBI-ProteinID: XP_010361861
UniProt: A0A2K6RWI3
LinkDB
Position
10
AA seq 359 aa
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTVDNVSVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRRGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVKCKKCTEIVDQYICK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgccctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattagctctgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcctgggctctcccctggccagaggaag
ctgtgccaactgtaccaggagcacatggcctacataggggagggagccaagacaggcatc
aaggagtgccagcaccagttccggcagcggcggtggaactgcagcacggtggacaacgtg
tctgtctttgggagagtcatgcagataggtagccgtgagaccgccttcacctatgcagtg
agcgccgcaggcgtggtcaacgccatcagccgggcctgtcgggagggcgagctctccacc
tgcggctgcagccggaccgcgcggcccaaggacctgccccgggactggctgtggggtggc
tgtggggacaatgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccaaaggatcagaggaacagggccgggtgctcatgaatctgcag
aacaacgaggcgggtcgcagggctgtgtataagatggcggacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtgggggaccggctgaaggagaagtatgacagcgcggccgccatgcgcgtcacccgcagg
ggccggctggagctggtcaacagccgcttcacccagcccaccccagaggacctggtctac
gtggaccccagccctgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggtcgtctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgtggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaagtgcaagaagtgcaccgagatcgtggaccagtacatctgtaaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663222
Entry
104663222         CDS       T03989                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04919  Thyroid hormone signaling pathway
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104663222 (WNT4)
   04390 Hippo signaling pathway
    104663222 (WNT4)
   04150 mTOR signaling pathway
    104663222 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104663222 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104663222 (WNT4)
   04916 Melanogenesis
    104663222 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    104663222 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663222 (WNT4)
   05205 Proteoglycans in cancer
    104663222 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104663222 (WNT4)
   05226 Gastric cancer
    104663222 (WNT4)
   05217 Basal cell carcinoma
    104663222 (WNT4)
   05224 Breast cancer
    104663222 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104663222 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    104663222 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104663222 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104663222 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104663222 (WNT4)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104663222 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 104663222
NCBI-ProteinID: XP_030769562
LinkDB
Position
12
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagtccccgctcctgcctgcgttcgctgcgcctcctcgtcttcgccgtcttctcagcc
gccgcgagcaactggctgtacctggccaagctgtcgtcagtgggaagcatctcagaggag
gagacgtgcgagaaactcaagggcctgatccagaggcaggtgcagatgtgcaagaggaac
ctggaagtcatggactcggtgcgtcgcggtgcccaactggccattgaggagtgccagtac
cagttccggaaccgacgctggaactgctccacactcgactccctgcccgtcttcggcaag
gtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcggcaggtgtg
gcctttgcagtgacacgggcgtgcagcagtggggagctggagaagtgtggctgtgaccgg
acggtgcatggggtcagcccacagggcttccagtggtcaggatgctctgacaacatcgcc
tacggtgtggccttctcacagtcgtttgtggatgtgcgggagagaagcaagggggcctcg
tccagcagagccctcatgaacctccacaacaatgaggccggcaggaaggccatcctgaca
cacatgcgggtggaatgcaagtgccacggggtgtcaggctcctgtgaggtaaagacgtgc
tggcgagccgtgccgcccttccgccaggtgggtcacgcactgaaggagaagtttgatggt
gccactgaggtggagccacgccgcgtgggctcctccagggcactggtgccacgcaatgca
cagttcaagccacacacagatgaggacctggtgtacttggagcccagccctgacttctgc
gagcaggacatgcgcagcggcgtgctgggcacaaggggccgcacatgcaacaagacgtcc
aaggccatcgacggctgtgagctgctgtgctgtggccgcggcttccacacggcgcaggtg
gagctggctgaacgctgcagctgcaaattccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagttgcacacgtgccgatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665095
Entry
104665095         CDS       T03989                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11 isoform X3
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104665095 (WNT11)
   04390 Hippo signaling pathway
    104665095 (WNT11)
   04150 mTOR signaling pathway
    104665095 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104665095 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104665095 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665095 (WNT11)
   05205 Proteoglycans in cancer
    104665095 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104665095 (WNT11)
   05226 Gastric cancer
    104665095 (WNT11)
   05217 Basal cell carcinoma
    104665095 (WNT11)
   05224 Breast cancer
    104665095 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104665095 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    104665095 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104665095 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104665095 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104665095 (WNT11)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104665095 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104665095
NCBI-ProteinID: XP_010365085
UniProt: A0A2K6PAX4
LinkDB
Position
15
AA seq 354 aa
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggcactgtccaagacaccagcagccctggcactgaac
cagacacaacactgcaagcagctggagggcctggtgtctgcacaggtgcagctgtgccgc
agcaacctggagctcatgcacacggtggtgcacgctgcccgcgaggtcatgaaggcctgt
cgccgggccttcgccgacatgcgctggaactgctcctccattgagctcgcccccaactat
ttgcttgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggccgcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgccgggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccatggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagctacgggatgtggctgctgacctcaagacccga
tacctgtcggccaccaaggtagtgcaccgacccatgggcacccgcaagcacctggtgccc
aaagacctggatatccggcctgtgaaggactcagaactcgtctacctgcagagctcacct
gacttctgcatgaagaatgagaaggtgggctcccatggaacacaagacaggcagtgcaac
aagacatccaatggaagtgacagctgcgatcttatgtgctgtgggcgtggctacaacccc
tatacagaccgcgtggtcgagcggtgccactgtaagtaccactggtgctgctacgtcacc
tgccgcaggtgtgagcgtaccgtggagcgctatgtctgcaagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672033
Entry
104672033         CDS       T03989                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a isoform X2
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104672033 (WNT9A)
   04390 Hippo signaling pathway
    104672033 (WNT9A)
   04150 mTOR signaling pathway
    104672033 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104672033 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104672033 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672033 (WNT9A)
   05205 Proteoglycans in cancer
    104672033 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104672033 (WNT9A)
   05226 Gastric cancer
    104672033 (WNT9A)
   05217 Basal cell carcinoma
    104672033 (WNT9A)
   05224 Breast cancer
    104672033 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104672033 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    104672033 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104672033 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104672033 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104672033 (WNT9A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104672033 (WNT9A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104672033
NCBI-ProteinID: XP_010374009
UniProt: A0A2K6PBW8
LinkDB
Position
8
AA seq 365 aa
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTVLPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtccccgctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttctgccgcctacttcgggctgacgggcagcgagcccctgact
gtcctcccgctgaccctggagcccgaggcggccgcccaggcacactacaaggcctgcgac
cggctgaagctggagcggaagcagcggcgcatgtgccgccgggacccgggtgtggcagag
acgctggtggaggccgtgagcatgagtgcgcttgagtgccagttccagttccgctttgag
cgctggaactgcacgctggagggccgctaccgggccagcctactcaagcgaggcttcaag
gagactgccttcctctatgccatctcctcggctggcctgacgcacgcactggccaaggca
tgcagcgcaggccgcatggagcgctgtacctgcgatgaggcgcccgacctggagaaccgt
gaggcctggcagtgggggggctgcggagacaacctcaagtacagcagcaagttcgtcaag
gagttcctgggcagacggtcaagcaaggatctgcgagcccgtgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacctgcaagtgccacggcgtg
tcaggctcatgcacggtgcggacctgctggcggcagctggcgcccttccatgaggtgggc
aagcacctgaagcacaagtatgagacagcactcaaggtgggcagcaccaccaacgaagct
gcaggcgaggcaggcgccatttccccaccacggggccgtgcctcgggggcgggcggcagt
gacccgctaccccgcactccagagctggtgcacctggacgactcgcctagcttctgcctg
gccggccgcttctccccgggcaccgctggccgtaggtgccaccgcgagaagaactgcgag
agcatctgctgcggccgcggccataacacacagagccgggtggtgacaaggccctgccag
tgccaggtgcgttggtgctgctatgtggagtgcaggcagtgcacacagcgtgaggaggtc
tacacctgcaagggctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672034
Entry
104672034         CDS       T03989                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104672034 (WNT3A)
   04390 Hippo signaling pathway
    104672034 (WNT3A)
   04150 mTOR signaling pathway
    104672034 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104672034 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104672034 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672034 (WNT3A)
   05206 MicroRNAs in cancer
    104672034 (WNT3A)
   05205 Proteoglycans in cancer
    104672034 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104672034 (WNT3A)
   05226 Gastric cancer
    104672034 (WNT3A)
   05217 Basal cell carcinoma
    104672034 (WNT3A)
   05224 Breast cancer
    104672034 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104672034 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    104672034 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104672034 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104672034 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104672034 (WNT3A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104672034 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104672034
NCBI-ProteinID: XP_010374010
UniProt: A0A2K6QGF3
LinkDB
Position
8
AA seq 352 aa
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRNQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccgctcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgtcgggccacagtattcctccctgggctcacagcccatc
ctgtgtgccagcattccaggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccatgacagcctggccatcttcgggcct
gtgctggacaaagctacgagggagtcagcctttgtccacgccattgcctcagctggtgtg
gcctttgcggtgacacgctcatgtgcagagggcacggccgccatctgtggctgcagcagt
cgcaaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaatgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacttgctggtggtcg
caacccgacttccgcgccattggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggatgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgtgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccccgagacgggttccttcggcacgcgcgaccggacctgcaacgtcagc
tcacacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgagagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676099
Entry
104676099         CDS       T03989                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104676099 (WNT7B)
   04390 Hippo signaling pathway
    104676099 (WNT7B)
   04150 mTOR signaling pathway
    104676099 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104676099 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104676099 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676099 (WNT7B)
   05205 Proteoglycans in cancer
    104676099 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104676099 (WNT7B)
   05226 Gastric cancer
    104676099 (WNT7B)
   05217 Basal cell carcinoma
    104676099 (WNT7B)
   05224 Breast cancer
    104676099 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104676099 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    104676099 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104676099 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104676099 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104676099 (WNT7B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104676099 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104676099
NCBI-ProteinID: XP_030771622
LinkDB
Position
13
AA seq 353 aa
MLLLSPRSALVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctactgtcgccgcgcagcgcgctcgtctctgtctattgcccgcagatctttctc
ctcctgtccagcggcagctacctagcactgtcatcagtggtggccctgggagccaacatc
atctgcaacaagattcctggcctagccccgcggcagcgtgccatctgccagagccggccc
gatgccatcattgtgatcggggagggggcgcagatgggcatcaacgagtgccagtaccag
ttccgctttggacgctggaactgctctgccctcggcgagaagactgtctttgggcaagag
ctccgagtagggagccgtgaggctgccttcacgtatgccatcaccgcggctggcgtagcg
cacgccgtcactgccgcctgcagccaaggcaacctgagcaactgcggctgtgaccgcgag
aagcagggctactacaaccaggccgagggctggaagtggggtggctgctcagccgacgtg
cgttacggcatcgacttctcccggcgcttcgtggacgctcgggagatcaagaagaacgcg
cggcgcctcatgaacctgcacaacaatgaggccggcaggaaggttctggaggaccggatg
cagctggagtgcaagtgtcacggtgtgtctggctcctgcaccaccaagacctgctggacc
acgctgcccaagttccgagaggtgggccacctgctgaaggagaagtacaacgcggccgtg
caggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgcatcaaacag
ctgcgcagctatcagaagcccatggagacggacctagtgtacatcgagaagtcgcccaac
tactgcgaggaggacgcggccacgggaagcgtgggcactcagggccgcctctgcaaccgc
acgtcgcccggtgcggacggctgtgacaccatgtgctgcggccgaggctacaacacccac
cagtacaccaaggtgtggcagtgcaactgcaaattccactggtgctgcttcgtcaagtgc
aacacctgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676516
Entry
104676516         CDS       T03989                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104676516 (WNT5A)
   04390 Hippo signaling pathway
    104676516 (WNT5A)
   04150 mTOR signaling pathway
    104676516 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104676516 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104676516 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    104676516 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676516 (WNT5A)
   05205 Proteoglycans in cancer
    104676516 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104676516 (WNT5A)
   05226 Gastric cancer
    104676516 (WNT5A)
   05217 Basal cell carcinoma
    104676516 (WNT5A)
   05224 Breast cancer
    104676516 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104676516 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    104676516 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104676516 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104676516 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104676516 (WNT5A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104676516 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104676516
NCBI-ProteinID: XP_010379638
UniProt: A0A2K6PGH6
LinkDB
Position
1
AA seq 380 aa
MKKSIGILSPGVALGMAGSAVSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
gtgtcttccaagttcttcctaatggctttggccatatttttctccttcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggagaaggcgcgaagacaggc
atcaaagagtgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcgggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagcgctcgcatcctcatgaacctg
cataacaacgaggcaggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtctggctcatgtagcctgaagacatgctggctgcagttggcggacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagtgcggcggccatgcggctcaacagc
cggggcaagttggtgcaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacatcgaccccagccctgactactgcgtgcgcaacgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677318
Entry
104677318         CDS       T03989                                 

Gene name
WNT16
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104677318 (WNT16)
   04390 Hippo signaling pathway
    104677318 (WNT16)
   04150 mTOR signaling pathway
    104677318 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104677318 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104677318 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677318 (WNT16)
   05202 Transcriptional misregulation in cancer
    104677318 (WNT16)
   05205 Proteoglycans in cancer
    104677318 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104677318 (WNT16)
   05226 Gastric cancer
    104677318 (WNT16)
   05217 Basal cell carcinoma
    104677318 (WNT16)
   05224 Breast cancer
    104677318 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104677318 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    104677318 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104677318 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104677318 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104677318 (WNT16)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104677318 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104677318
NCBI-ProteinID: XP_010380607
UniProt: A0A2K6PIA1
LinkDB
Position
6
AA seq 365 aa
MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIGEGARLGIQECRSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMRFSR
KFLDFPXRNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggacagggcggcgctcctgggactggcccgcctgtgcgcgctgtgggcagccctgctc
gtgctgttcccctacggagcccaaggaaactggatgtggttgggcattgcctccttcggg
gttccagagaagctgggctgcgccaatttaccgctgaacagccgccagaaggagctgtgc
aagaggaagccgtacctgctgccgagcatcggagagggcgcccggctgggcattcaggag
tgcaggagtcagttcagacacgagagatggaactgcatgatcaccgctgccgccaccact
gccccgatgggcgccagccccctctttggctacgagctgagcagcggcaccaaagagaca
gcatttatttatgctgttatggctgcaggcctggtgcattctgtgaccaggtcatgcagt
gcaggcaacatgacagagtgttcctgtgacaccaccttgcagaacggcggctcagcaagt
gaaggatggcactgggggggctgctccgatgatgtccagtatggcatgcggttcagcaga
aagttcctagatttcccantcagaaacaccacgggcaaagaaaacaaagtactattagca
atgaacctacataacaatgaagctggaaggcaggctgtcgccaagttgatgtcagtagac
tgccgctgccacggagtttccggctcctgtgctgtgaaaacatgctggaaaaccatgtct
tcttttgaaaagattggccatttgttgaaggataaatatgaaaacagtatccaaatatca
gacaaaataaagaggaaaatgcgcaggagagaaaaagatcagaggaaaataccaatccac
aaggatgatctgctctatgttaataagtctcccaactactgtgtagaagataagaaactg
ggaatcccagggacacaaggcagagaatgcaaccgtacatcagagggtgcagatggctgc
aacctcctctgctgtggccgaggttacaacacccacgtggtccggcacgtggagaggtgt
gagtgtaagttcatctggtgctgctatgtccgttgcaggaggtgtgaaagcatgactgat
gtccacacttgcaagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679020
Entry
104679020         CDS       T03989                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104679020 (WNT7A)
   04390 Hippo signaling pathway
    104679020 (WNT7A)
   04150 mTOR signaling pathway
    104679020 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104679020 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104679020 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679020 (WNT7A)
   05205 Proteoglycans in cancer
    104679020 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104679020 (WNT7A)
   05226 Gastric cancer
    104679020 (WNT7A)
   05217 Basal cell carcinoma
    104679020 (WNT7A)
   05224 Breast cancer
    104679020 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104679020 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    104679020 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104679020 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104679020 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104679020 (WNT7A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104679020 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 104679020
NCBI-ProteinID: XP_010382776
UniProt: A0A2K6RP84
LinkDB
Position
1
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctagctcctagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcactgtcttcgggaaggagctgaaagtgggg
agccgggaggctgcgttcacctacgccatcattgctgccggcgtggcccatgccatcaca
gctgcctgtacccagggcaacctaagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagaggcccaccttcctgaagatcaagaagccactgtcatac
cgcaagcccatggacacagacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggccccccag
gccagtggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgt
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679729
Entry
104679729         CDS       T03989                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104679729 (WNT1)
   04390 Hippo signaling pathway
    104679729 (WNT1)
   04150 mTOR signaling pathway
    104679729 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104679729 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104679729 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679729 (WNT1)
   05205 Proteoglycans in cancer
    104679729 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104679729 (WNT1)
   05226 Gastric cancer
    104679729 (WNT1)
   05217 Basal cell carcinoma
    104679729 (WNT1)
   05224 Breast cancer
    104679729 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104679729 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    104679729 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104679729 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104679729 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104679729 (WNT1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104679729 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104679729
NCBI-ProteinID: XP_010383724
UniProt: A0A2K6NBC9
LinkDB
Position
10
AA seq 370 aa
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctactggcgctggcc
gctctgcccgcagctctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgctgacggactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctacagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggttacccattcggtggcg
cgctcctgctcagagggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggctggccgtacgactgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggttcctgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtatacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggtacagcgggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgtaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679730
Entry
104679730         CDS       T03989                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104679730 (WNT10B)
   04390 Hippo signaling pathway
    104679730 (WNT10B)
   04150 mTOR signaling pathway
    104679730 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104679730 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104679730 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679730 (WNT10B)
   05205 Proteoglycans in cancer
    104679730 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104679730 (WNT10B)
   05226 Gastric cancer
    104679730 (WNT10B)
   05217 Basal cell carcinoma
    104679730 (WNT10B)
   05224 Breast cancer
    104679730 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104679730 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    104679730 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104679730 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104679730 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104679730 (WNT10B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104679730 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104679730
NCBI-ProteinID: XP_010383726
UniProt: A0A2K6RSD6
LinkDB
Position
10
AA seq 389 aa
MPEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGSSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSHLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccggaggagccccggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gcgttgtgcagtcgggctctaagcaatgagattctgggcctgaagttgcctggcgaaccg
ccgctgacggccaacaccgtgtgcttgacgctgtccggcctgagcaagcggcagctaggc
ctgtgcttgcgcaaccccgacgtgacggcgtcggcgcttcagggtctgcacatcgcggtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcagcgctcgagggcggt
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagaaagtgctttttcc
ttctccatgctggctgctggggtcatgcacgcagtagccactgcctgcagcctgggcaag
ctggtgagctgtggctgtggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcattgtcccgaggcaagagtttcccccactctctgcccagccct
ggccctggctcaggctccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtagggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgtcatggcacgtcaggcagctgccagttcaagaca
tgctggagggcggccccagagttccgggcagtgggggcggcgttgagggagcggctgggc
cgggccatcttcatcgatacccacaaccgcaattctggagccttccagccccgtctgcgt
cctcgtcgcctctcaggagagctggtctactttgagaagtctcctgacttctgtgagcga
gaccccactatgggctccccagggacaaggggccgggcctgcaacaagaccagccacctg
ttggatggctgtggcagcctgtgctgtggccgtgggcacaacgtgctccggcagacacga
gttgagcgctgccattgccgcttccactggtgctgctatgtgctgtgtgatgagtgcaag
gttacagagtgggtgaatgtgtgtaagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681717
Entry
104681717         CDS       T03989                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a isoform X1
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104681717 (WNT8A)
   04390 Hippo signaling pathway
    104681717 (WNT8A)
   04150 mTOR signaling pathway
    104681717 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104681717 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104681717 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104681717 (WNT8A)
   05205 Proteoglycans in cancer
    104681717 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104681717 (WNT8A)
   05226 Gastric cancer
    104681717 (WNT8A)
   05217 Basal cell carcinoma
    104681717 (WNT8A)
   05224 Breast cancer
    104681717 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104681717 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    104681717 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104681717 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104681717 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104681717 (WNT8A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104681717 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104681717
NCBI-ProteinID: XP_010386378
LinkDB
Position
3
AA seq 355 aa
MGSLSMLWAAVGICCAALSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDGSKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWAPAEA
FLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQ
VEERKTEVISSCNCKFQWCCKVKCDQCRHVVSKYYCTRSSGSAQSLRRVWFGVHI
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggggagcctgtctatgctctgggcagctgtgggcatatgctgtgctgcactcagcgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctacctgacctacacg
actagcgtggccttgggtgcccagagtggcatcgaggaatgcaagttccagtttgcttgg
gaacgctggaactgccctgaaaatgctcttcagctctctacccacaataggctgagaagt
gccaccagagagacttccttcatacatgctatcagctctgctggagtcatgtacaccatc
accaagaactgtagcatgggtgacttcgaaaactgtggctgtgatgggtcaaaaaatgga
aaaacaggaggccatggctggatctggggaggctgcagtgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagtttggagaaggggaaggatgccagagccctgatg
aatcttcacaacaacagggccggcagactggcagtgagagccaccatgaaaaggacctgc
aaatgtcatggcatctctggaagctgcagcatacagacgtgctggctgcagctggctgac
ttccgggagatgggagactacctaaaggccaagtatgaccaggcgctgaaaattgaaatg
gataagcggcagctgagagctgggaacagcgccgagggccactgggcgcccgctgaggcc
ttccttcctagtgcagaggcggaactgatctttttagaggaatcaccagattactgtacc
tgcaattccagcctgggcatctatggcacagagggtcgtgagtgcctacagaacagccac
aacacatccaggtgggagcgacgtagctgtgggcgcctgtgcactgaatgtgggctgcag
gtggaagagaggaaaactgaggtcataagtagctgtaactgcaaattccagtggtgctgt
aaggtcaagtgtgaccagtgtaggcatgtggtgagcaagtattactgcacacgctcctca
ggcagtgcccagtccctgaggagagtttggtttggggtccatatctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682399
Entry
104682399         CDS       T03989                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104682399 (WNT3)
   04390 Hippo signaling pathway
    104682399 (WNT3)
   04150 mTOR signaling pathway
    104682399 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104682399 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104682399 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682399 (WNT3)
   05206 MicroRNAs in cancer
    104682399 (WNT3)
   05205 Proteoglycans in cancer
    104682399 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104682399 (WNT3)
   05226 Gastric cancer
    104682399 (WNT3)
   05217 Basal cell carcinoma
    104682399 (WNT3)
   05224 Breast cancer
    104682399 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104682399 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    104682399 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104682399 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104682399 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104682399 (WNT3)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104682399 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104682399
NCBI-ProteinID: XP_010387342
UniProt: A0A2K6QK28
LinkDB
Position
19
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaaactgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtcctcgacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccaccatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgaa
gacgctgacttcggggtgttagtgtccagagagttcgcggacgcgcgtgagaacaggccg
gacgcacgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgtcacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccattggcgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccgcccaccgagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacaggttcttttggcacaagggaccggacttgc
aatgtcacctcccatggcattgatggctgcgatctgctctgctgtggccgtggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgatgtgcacacctgcaagtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682400
Entry
104682400         CDS       T03989                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104682400 (WNT9B)
   04390 Hippo signaling pathway
    104682400 (WNT9B)
   04150 mTOR signaling pathway
    104682400 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104682400 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104682400 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682400 (WNT9B)
   05205 Proteoglycans in cancer
    104682400 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104682400 (WNT9B)
   05226 Gastric cancer
    104682400 (WNT9B)
   05217 Basal cell carcinoma
    104682400 (WNT9B)
   05224 Breast cancer
    104682400 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104682400 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    104682400 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104682400 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104682400 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104682400 (WNT9B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104682400 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104682400
NCBI-ProteinID: XP_010387343
UniProt: A0A2K6PMR5
LinkDB
Position
19
AA seq 357 aa
MRPQPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKL
SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRTGLLKRGFKETAFLY
AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
RGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
RYDSAVKVSSATNEALGRLELWAPSRQGSPTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcgcccccagcccgcgctggccctggccgggctctgcctgctggcgctgcccgccgcc
gccgcctcctacttcggcctgactgggcgggaggtcctgacgcccttcccaggactgggc
actgcggcggccccggcacagggcggggcccacctgaagcagtgcgacctgctgaagctg
tcccggcggcagaagcagctctgccggagggagcctggcctggctgagaccctgcgggac
gctgcgcacctcggcctgcttgagtgccagttccagttccggcatgagcgctggaactgt
agcctggagggcaggacgggcctgctcaagagaggcttcaaagagacagctttcctgtac
gcggtgtcctctgccgccctaacccacaccctggcccgggcctgcagcgctgggcgcatg
gagcgctgcacctgtgatgactctccggggctggagagccggcaggcctggcagtggggc
gtgtgtggtgacaacctcaagtacagcaccaagtttctgagcaacttcctggggtccaaa
agaggaaacaaggacctgcgggcacgggcagacgcccacaacacccacgtgggcatcaag
gctgtaaagagtggcctcaggacgacgtgtaagtgccacggcgtgtcaggctcctgtgcc
gtgcgcacctgctggaagcagctctccccgttccgtgagacgggccaagtgctaaaactg
cgctatgactcggctgtcaaggtgtccagtgccaccaatgaggccttgggccgcctagag
ctgtgggccccttccaggcagggcagccccaccaaaggcctggccccgaggtctggggac
ctggtctacatggaggactcgcccagcttctgccggcccagcaagtactcgcctggcacg
gcaggtagggtatgctcccgggaggccagctgcagcagcctgtgctgcgggcggggctat
gacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgctat
gtggagtgccagcaatgtgtgcaggaggagcttgtgtacacctgcaagcactag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682628
Entry
104682628         CDS       T03989                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104682628 (WNT2)
   04390 Hippo signaling pathway
    104682628 (WNT2)
   04150 mTOR signaling pathway
    104682628 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104682628 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104682628 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682628 (WNT2)
   05205 Proteoglycans in cancer
    104682628 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104682628 (WNT2)
   05226 Gastric cancer
    104682628 (WNT2)
   05217 Basal cell carcinoma
    104682628 (WNT2)
   05224 Breast cancer
    104682628 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104682628 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    104682628 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104682628 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104682628 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104682628 (WNT2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Morphogens
   104682628 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 104682628
NCBI-ProteinID: XP_010387638
UniProt: A0A2K6NI98
LinkDB
Position
6
AA seq 360 aa
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCVRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggaccgcggaatgccagcaccagttc
cgccagcaccgctggaattgcaacactctggacagggatcacagcctctttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaagtaaaatcttgttcctgtgatccaaag
aagatgggaagcgccaaggacagcaagggcatttttgattggggtggctgcagtgataac
attgactatgggatcaaatttgcccgtgcattcgtggatgccaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcataacaacagagctggcaggaaggctgtaaagcga
ttcttgaaacaagagtgcaaatgccatggggtgagcggctcgtgtactctaaggacatgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacaaaaaatgacctcgtgtattttgagaattctccagactactgtgtcagg
gaccgagaggcaggctccctgggtacagcaggccgagtgtgcaacctgacttcccggggc
atggacagctgcgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgaccaagtgtggatgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaggccctggacgtgcacacatgcaaggcccccaagaacgctgactggacaacccccaca
tga

DBGET integrated database retrieval system