KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656494
Entry
104656494         CDS       T03989                                 

Gene name
LBX1
Definition
(RefSeq) transcription factor LBX1
  KO
K09353  homeobox protein LBX
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104656494 (LBX1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104656494 (LBX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 104656494
NCBI-ProteinID: XP_010354423
UniProt: A0A2K6RNS0
LinkDB
Position
11
AA seq 281 aa
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLL
AAADKHAPGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ
TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL
KRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLSPG
APQAPGAGPLQLSPASPLTDQPASSQDCSEDEEDEEIDVDD
NT seq 846 nt   +upstreamnt  +downstreamnt
atgacttccaaggaggacggcaaggcggcgccgggggaggagcggcggcgcagtccgctg
gaccacctgcctccgcctgccaactccaacaagccgctgacgccgttcagcatcgaggac
atcctcaacaagccgtctgtgcggagaagttactcgctgtgcggggcggcgcacctgctg
gccgccgcggacaagcacgcgccgggcggcttgcccctggctggccgggcgctgctctcg
cagacctcgccactgtgcgcgctggaggagctcgccagcaagacgtttaaggggctggag
gtcagcgttctgcaggcagccgaaggccgcgacgggatgaccatctttgggcagcggcag
acccctaagaagcggcgaaagtcgcgcacggccttcaccaaccaccagatctatgaattg
gaaaagcgctttctataccagaagtacctgtcccccgccgatcgcgaccaaatcgcgcag
cagctgggcctcaccaatgcgcaagtcatcacctggttccagaatcggcgcgctaagctc
aagcgggacctggaggagatgaaggccgacgtagagtccgccaagaaactgggccccagc
gggcagatggacatcgtggcgctggccgaactcgagcagaactcggaggccacagccggc
ggtggcggcggctgcggcagggctaagtcgaggcccggctctccggtcctctccccaggc
gccccgcaggccccgggcgctggccccctgcagctctcgcctgcctctccgctcacggac
cagccggccagcagccaggactgctcggaggacgaggaagacgaagagatcgacgtggac
gattga

DBGET integrated database retrieval system