KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656543
Entry
104656543         CDS       T03989                                 

Gene name
CALHM1
Definition
(RefSeq) calcium homeostasis modulator protein 1
  KO
K19738  calcium homeostasis modulator protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104656543 (CALHM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104656543 (CALHM1)
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104656543 (CALHM1)
SSDB
Motif
Pfam: Ca_hom_mod
Other DBs
NCBI-GeneID: 104656543
NCBI-ProteinID: XP_010354510
LinkDB
Position
11
AA seq 345 aa
MDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAPP
LVLFLFGLVMNNNVSMLAEEWKRPPGRRAKDPAVLRYMFCSMAQRALIAPIIWVAVTLLD
GKCFLCAFCTAVPVTALGNGSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYLR
CISQALGWSFVLLTTLLAFVVRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAKA
FAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTPPDGAEEEREKLRGITDQGTMNR
LLTSWHKCKPPLQLGREEPPLMGNGWAGGGPRPPRKEVATYFSKV
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggacaagttccggatgatcttccagttcctgcagtccaaccaggagtccttcatgaac
ggcatctgcggcatcatggccctggccagtgcccagatgtactcggcctttgactttaac
tgcccctgcctgccgggctacaatgcggcctacagcgcgggcatcctgctggcgccaccc
ctggtgctcttcctgtttggcctggtcatgaacaacaacgtgtccatgctggccgaagaa
tggaagcggccgccgggccgccgggccaaggaccccgctgtgttgcgctacatgttctgc
tccatggcccagcgcgccctcatcgcgcccatcatctgggtggccgtcacactgctcgac
ggcaaatgcttcctctgtgccttctgcactgccgtgcccgtgaccgcactgggcaatggc
agcctggcacccggtctacctgcccctgagcttgcccgcctgctggcccgggtgccctgc
cctgagatctacgatggcgactggctgctggcccgagaggtggccgtgcgctacctccgc
tgcatctcccaggcgctgggctggtccttcgtgctgctgaccacactgctggcattcgtg
gtgcgttctgtgcggccctgcttcacgcaggccgccttcctcaagagcaagtactggtcc
cactatatcgacatcgagcgcaagctcttcgacgagacatgcacggagcacgccaaggcc
ttcgccaaggtctgcatccagcagttcttcgaggccatgaaccatgacctggagctgggt
cacacccacgggacactggccacggcccctgcttccgcggctgcccccacaccccccgat
ggtgcggaggaggaaagggagaagctgcgtggcatcacggatcaaggcaccatgaacagg
ctactcacaagctggcacaaatgcaaaccacctctgcagctgggcagggaggagccaccg
ctgatgggcaatggctgggctgggggcgggccccggcctccgcgcaaggaggtggccacc
tactttagcaaagtatga

DBGET integrated database retrieval system