KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656552Help
Entry
104656552         CDS       T03989                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00480  Glutathione metabolism
rro00980  Metabolism of xenobiotics by cytochrome P450
rro00982  Drug metabolism - cytochrome P450
rro00983  Drug metabolism - other enzymes
rro01524  Platinum drug resistance
rro05200  Pathways in cancer
rro05204  Chemical carcinogenesis
rro05225  Hepatocellular carcinoma
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104656552 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104656552 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    104656552 (GSTO1)
   00983 Drug metabolism - other enzymes
    104656552 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    104656552 (GSTO1)
   05204 Chemical carcinogenesis
    104656552 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    104656552 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    104656552 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    104656552 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104656552 (GSTO1)
Enzymes [BR:rro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104656552 (GSTO1)
Transporters [BR:rro02000]
 Other Transporters
  Pores ion channels [TC:1]
   104656552 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C GST_C_5 Glutaredoxin Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 104656552
NCBI-ProteinID: XP_010354521
UniProt: A0A2K6PFI7
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPEGSIRVYSMRFCPFAERTLLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLLGSFIRSQNKEDHAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMTLYECVDHTPKLKLWMAAMKKDPTVSALLISEKDWQGFLELYVQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtctgccaggagcctggggaaaggaagcgcgcccccggggccggtcccg
gagggctcgatccgcgtctacagcatgaggttctgcccgtttgctgagaggacgcttctg
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctatgagtctcccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttgctaggaagctttattagaagccaaaataaagaagaccatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgacgttctttggtggcaattctatctctatgattgattatctcatctggccctgg
tttgaacggctggaagcaatgacgttatatgaatgtgtagaccacactccaaaacttaaa
ctgtggatggcagccatgaagaaagatcccacagtctcagccctgctcatcagtgagaag
gactggcaaggtttcctagagctttacgtacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system