KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656556
Entry
104656556         CDS       T03989                                 

Gene name
NKX2-3
Definition
(RefSeq) homeobox protein Nkx-2.3
  KO
K09343  homeobox protein Nkx-2.3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104656556 (NKX2-3)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104656556 (NKX2-3)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104656556
NCBI-ProteinID: XP_030796935
LinkDB
Position
11
AA seq 365 aa
MMLPSPVTSTPFSVKDILNLEQQQQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGE
EDEEEEGDKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSGPKEHEEEPEVVRDRSQK
SCQLKKSLEAAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREH
LASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVT
PSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSGSYGCAYPAGGG
GGGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGGAQPLHQGAAAGAACAQGTLQ
GIRAW
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgatgttaccaagcccggtcacctccacccctttctcagtcaaagacattttgaatctg
gagcagcagcagcagcacttccatggtgcgcacttgcaggcggacttggagcaccacttc
cactctgcgccctgcatgctggccgcagctgaggggacgcaattttctgacggaggggag
gaggacgaggaagaagagggcgataaattgtcctatttgaactcactagccgcagccgac
ggccacggggattcagggttgtgtccccagggctatgtccacacggtcctgcgagactcg
tgcagcggccccaaggaacacgaagaggagcccgaggtcgtgagggaccggagccaaaaa
agctgccagctgaagaagtctctagaggcggcgggagactgcaaggcagcggaggagagc
gagaggccaaaaccacgcagccgccggaagccccgggtccttttctcgcaagcccaggtc
ttcgagctggaacgcaggttcaagcagcagcggtacctgtcggcacccgagcgcgagcac
ctcgccagcagcctgaagctcacgtccacgcaggtgaaaatctggttccagaatcgcagg
tacaagtgcaagagacagcggcaggacaagtctctggagctgggcgcacacgcgcccccg
ccgccgccccgccgcgtggcggtcccagtgctggtgcgggacggcaagccgtgcgtcacg
cccagcgcgcaggcctacggcgcgccctacagcgtgggtgccagcgcctactcctacaac
agcttccccgcctatggctatgggaactcggccgcggccgccgccgcagccgctgctgcc
gccgcggccgccgcggcctacagcggcagctatggctgtgcgtacccggcgggcggcggc
ggcggcggcggcggcgggacctccgcggcgaccactgccatgcagcccgcctgcagcgcg
gccggaggcggtccctttgtgaacgtgagcaacctaggaggcttcggcagcggcggcggc
gcacagccgttgcaccagggtgctgcagccggggccgcgtgcgctcagggcaccttgcag
ggcatccgggcctggtag

DBGET integrated database retrieval system