KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656623
Entry
104656623         CDS       T03989                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104656623 (CREB3L2)
   04024 cAMP signaling pathway
    104656623 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    104656623 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    104656623 (CREB3L2)
   04152 AMPK signaling pathway
    104656623 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104656623 (CREB3L2)
   04922 Glucagon signaling pathway
    104656623 (CREB3L2)
   04915 Estrogen signaling pathway
    104656623 (CREB3L2)
   04926 Relaxin signaling pathway
    104656623 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    104656623 (CREB3L2)
   04918 Thyroid hormone synthesis
    104656623 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    104656623 (CREB3L2)
   04916 Melanogenesis
    104656623 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    104656623 (CREB3L2)
   04927 Cortisol synthesis and secretion
    104656623 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104656623 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104656623 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    104656623 (CREB3L2)
   04728 Dopaminergic synapse
    104656623 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    104656623 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    104656623 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104656623 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    104656623 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104656623 (CREB3L2)
   05020 Prion disease
    104656623 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    104656623 (CREB3L2)
   05031 Amphetamine addiction
    104656623 (CREB3L2)
   05034 Alcoholism
    104656623 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104656623 (CREB3L2)
   04934 Cushing syndrome
    104656623 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104656623 (CREB3L2)
   05161 Hepatitis B
    104656623 (CREB3L2)
   05163 Human cytomegalovirus infection
    104656623 (CREB3L2)
   05165 Human papillomavirus infection
    104656623 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104656623 (CREB3L2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104656623 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 104656623
NCBI-ProteinID: XP_010354619
UniProt: A0A2K6RUJ4
LinkDB
Position
6
AA seq 520 aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPVTHVTTSDSFNDDEVESEKWYLSTDF
PSATIKTEPITDEPPPGLVPSVTLTITAVSTPFEKGEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEEPSSPGSAGELGGWDRGSSLLRVSTLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggaaagcggggagcagggcgtgctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgaccctttcctctcagagaag
agtgtgtcaatggaagtggaaccttccccgacgtccccggcgcctctcatccaggctgag
cacagctactccctttgtgaggagcctcgggcccagtcgcccgtcacccacgttaccacc
agtgacagcttcaatgacgatgaggtggaaagtgagaaatggtacctgtctacagacttc
ccttcagcaaccatcaagacagagccaattacagatgaaccacccccaggactcgttccg
tctgtcactctgaccatcacagctgtctccaccccgtttgaaaagggggaacctcctctg
gaaatgaatactggggttgattcttcgtgccagaccattattcctaaaattaagctggag
cctcatgaagtggatcagtttctaaacttctctcctaaagaagccccagtggaccacctg
catttgccacccacgcccccgagcagtcacggcagtgactcagaaggcagcctgagtccc
aacccacgcctgcaccccttcagcctgcctcagacccacagcccctccagagctgcaccc
cgggccccctccgccctctccagctcccctctcctcacggctcctcataaactgcagggg
tcgggccctctggtcctgacagaggaggaaaagaggaccctgatcgctgagggctatccc
atccccaccaaattgcccctgtcaaaatcagaggaaaaggccctgaagaaaattcggagg
aagatcaagaataagatttctgcccaagaaagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggtg
gaggttctagagaacactaacaggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagccggcacgcagactggcacctgcctc
atggttgtggtgctgtgctttgctgttgcattcggcagcttctttcaaggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattccctgcaggagccctacact
gcctccgtggtgagatccaggaacctgctgatctatgaggaacattctcccccagaagag
ccgtccagcccaggctcggctggggagctggggggctgggatagaggttcctccctgctc
agggtgtcaacgctggagtccaggccggatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgctcttggagctgcagcagcacctggtcagcgccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaacaccactttc
taa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663511
Entry
104663511         CDS       T03989                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104663511 (CREB3L4)
   04024 cAMP signaling pathway
    104663511 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    104663511 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    104663511 (CREB3L4)
   04152 AMPK signaling pathway
    104663511 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104663511 (CREB3L4)
   04922 Glucagon signaling pathway
    104663511 (CREB3L4)
   04915 Estrogen signaling pathway
    104663511 (CREB3L4)
   04926 Relaxin signaling pathway
    104663511 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    104663511 (CREB3L4)
   04918 Thyroid hormone synthesis
    104663511 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    104663511 (CREB3L4)
   04916 Melanogenesis
    104663511 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    104663511 (CREB3L4)
   04927 Cortisol synthesis and secretion
    104663511 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104663511 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104663511 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    104663511 (CREB3L4)
   04728 Dopaminergic synapse
    104663511 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    104663511 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    104663511 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104663511 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    104663511 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104663511 (CREB3L4)
   05020 Prion disease
    104663511 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    104663511 (CREB3L4)
   05031 Amphetamine addiction
    104663511 (CREB3L4)
   05034 Alcoholism
    104663511 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104663511 (CREB3L4)
   04934 Cushing syndrome
    104663511 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104663511 (CREB3L4)
   05161 Hepatitis B
    104663511 (CREB3L4)
   05163 Human cytomegalovirus infection
    104663511 (CREB3L4)
   05165 Human papillomavirus infection
    104663511 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104663511 (CREB3L4)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104663511 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 EMP24_GP25L JMY ATG16 OppC_N HAUS-augmin3 HALZ KASH_CCD DUF1664 Jnk-SapK_ap_N MCU YabA UPF0242 DUF4200 DUF724
Other DBs
NCBI-GeneID: 104663511
NCBI-ProteinID: XP_010363039
UniProt: A0A2K6NGX9
LinkDB
Position
8
AA seq 395 aa
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDHGCGL
QESEPEDFLKLFIDPNEVYCSEASPGNDSGISEDPCRPDSPPAPRATSSPPLYEVVYEAG
ALERMQGETGPTVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTLAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQGRPETGPEDYQPHGVTSRNILTHKDITENLETQVVESRLREPP
GAKDANDSTRTLLEKMGGKPRPSGRIGTVLHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatctcggaatccctgacctgctggacgcgtggctggagcccccagaggatatcttc
tcgacaggatccgtcctggagctgggactccactgcccgcctccagaggttccggtgact
aggctacaggaacagggactgcaaggctggaagtccggtggggaccatggctgtggcctt
caagagagtgagcctgaagatttcttgaagcttttcattgatccaaatgaggtgtactgc
tcggaagcatctcctggcaatgacagtggcatctctgaggacccctgccgtccagacagt
ccccctgcccccagggcaaccagttctcctccactctatgaggttgtctatgaggcaggg
gccctggagaggatgcagggggaaactgggccaactgtaggcctcatctccatccagcta
gatcagtggagcccagcatttatggtacctgattcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcttgcccagagcaggcaccttagccccagtgccttgtacaacc
ctgctgccctgtcaaaccctgttcctgacggatgaggagaagcgtctgctggggcaggaa
ggggtttctctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaggag
tacattgatgggctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaatatctccttggtagctcagctccgccagctg
cagacgctaattgctcaaacttccaacaaagccgcccagaccagcacttgtgttctgatt
cttcttttttccctggctctcatcatcctgcccagcttcagtccattccaaggtcgacca
gaaactgggcctgaggattaccagcctcacggagtgacttccagaaatatcctgacccac
aaggacataacagaaaatctggagacccaagtggtagagtccagactgagggagccacct
ggagccaaggatgcaaatgactcaacaaggacactgcttgagaagatgggagggaagcca
agacccagtgggcgcatcgggacggtgctgcatgcagatgagatgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665486
Entry
104665486         CDS       T03989                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104665486 (CREB3L3)
   04024 cAMP signaling pathway
    104665486 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    104665486 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    104665486 (CREB3L3)
   04152 AMPK signaling pathway
    104665486 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104665486 (CREB3L3)
   04922 Glucagon signaling pathway
    104665486 (CREB3L3)
   04915 Estrogen signaling pathway
    104665486 (CREB3L3)
   04926 Relaxin signaling pathway
    104665486 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    104665486 (CREB3L3)
   04918 Thyroid hormone synthesis
    104665486 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    104665486 (CREB3L3)
   04916 Melanogenesis
    104665486 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    104665486 (CREB3L3)
   04927 Cortisol synthesis and secretion
    104665486 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104665486 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104665486 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    104665486 (CREB3L3)
   04728 Dopaminergic synapse
    104665486 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    104665486 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    104665486 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104665486 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    104665486 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104665486 (CREB3L3)
   05020 Prion disease
    104665486 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    104665486 (CREB3L3)
   05031 Amphetamine addiction
    104665486 (CREB3L3)
   05034 Alcoholism
    104665486 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104665486 (CREB3L3)
   04934 Cushing syndrome
    104665486 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104665486 (CREB3L3)
   05161 Hepatitis B
    104665486 (CREB3L3)
   05163 Human cytomegalovirus infection
    104665486 (CREB3L3)
   05165 Human papillomavirus infection
    104665486 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104665486 (CREB3L3)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104665486 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 DUF1664 ZapB
Other DBs
NCBI-GeneID: 104665486
NCBI-ProteinID: XP_030792304
LinkDB
Position
8
AA seq 483 aa
MDGPPAWSRDPPKHLQTELDGPMNMDLAAGKMACSACPMDPINSFELLDLLFDRQDGILR
HVELGDDWGHVKDQQVQPNPDPDDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQ
DTPACNGPAASPAGCHPAQPGKGPCLSYNPGNSCPTTPPGPVVQVPEASVTIDLEMWSPG
GRTYAEKQADPVHVSPRCNLTVKDLLLSGSSGDLQQHHLGVSHLLRPGAEHCQELVLTED
EKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSAC
AAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPS
ISPFGPNKAESPGDFAPVRVFSRTLHNDAASRVTSDAVPGSEAPGPQPEADTTREGSPGS
PGADWGIRDTANLTNWMEEVDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAG
DEL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggatgggcctccagcttggagcagagaccccccaaagcatctgcagacagagctggat
ggacccatgaatatggatttagctgctggaaagatggcttgttctgcctgccccatggac
cccatcaacagctttgagctcctggatctcctgtttgaccggcaggacggcatcctgaga
cacgtggagctgggcgacgactggggccacgtcaaggaccagcaggtccagccaaacccc
gaccctgacgacttcctcagctccatcctgggctccggagactcactgcccagctcccca
ctctggtcccccgaaggcagtgatagtggcatctctgaagacctcccctccgacccccag
gacacccctgcatgcaacggaccagccgcctccccagccggctgccatcctgcccagcct
ggcaaggggccctgcctctcctataatcctggcaactcttgccccaccacacccccaggg
ccagtggtccaagtgcctgaagcctctgtgaccatagacctggaaatgtggagcccagga
ggaaggacctatgctgagaaacaggctgacccggtgcacgtgtccccacgatgcaatctc
accgtgaaagatctcctcctttcgggcagcagcggggacctgcaacagcatcacctgggg
gtctcccacctcctgagacctggggctgagcactgtcaggagctggtgctcactgaggat
gagaagaaactgctggctaaagaaggcatcacgctgcccactcagctgcccctcactaaa
tacgaggagcgagtgctgaaaaaaatccgccggaaaatccggaacaagcagtcggcccaa
gaaagcaggaagaagaaaaaggaatatatcgacggcctggagactcggatgtcagcttgc
gctgctcagaatcaggagttacagaggaaagtcttgcatctcgagaagcaaaacctgtcc
ctcttggagcagctgaagaaactccaggccattgtggtgcaatccaccagcaagtcagcc
cagacaggcacctgtgttgcggtcctgttgctgtcctttgccctcattatcctcccgtcc
atcagcccctttggccccaacaaagccgagagccccggggactttgcgcctgtgcgagtg
ttctccagaactttgcacaacgatgctgcctcccgcgtgacctctgatgctgtgccgggc
tccgaggccccaggaccccaacccgaggctgacacaacccgagaagggtctccaggaagc
cccggggcagactggggcatccgggacactgcgaacctgaccaattggatggaggaggtg
gacaacgccaccctggtcctgaggaatgcaacagaggggctgggccaggtcgccctgctg
gactgggtggcgcctgggccaagcactggctcaggacgtgcagggctggaggcggcggga
gacgagctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668385
Entry
104668385         CDS       T03989                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104668385 (CREB3L1)
   04024 cAMP signaling pathway
    104668385 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    104668385 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    104668385 (CREB3L1)
   04152 AMPK signaling pathway
    104668385 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104668385 (CREB3L1)
   04922 Glucagon signaling pathway
    104668385 (CREB3L1)
   04915 Estrogen signaling pathway
    104668385 (CREB3L1)
   04926 Relaxin signaling pathway
    104668385 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    104668385 (CREB3L1)
   04918 Thyroid hormone synthesis
    104668385 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    104668385 (CREB3L1)
   04916 Melanogenesis
    104668385 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    104668385 (CREB3L1)
   04927 Cortisol synthesis and secretion
    104668385 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104668385 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104668385 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    104668385 (CREB3L1)
   04728 Dopaminergic synapse
    104668385 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    104668385 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    104668385 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104668385 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104668385 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104668385 (CREB3L1)
   05020 Prion disease
    104668385 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    104668385 (CREB3L1)
   05031 Amphetamine addiction
    104668385 (CREB3L1)
   05034 Alcoholism
    104668385 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104668385 (CREB3L1)
   04934 Cushing syndrome
    104668385 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668385 (CREB3L1)
   05161 Hepatitis B
    104668385 (CREB3L1)
   05163 Human cytomegalovirus infection
    104668385 (CREB3L1)
   05165 Human papillomavirus infection
    104668385 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104668385 (CREB3L1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104668385 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 104668385
NCBI-ProteinID: XP_010369358
UniProt: A0A2K6R694
LinkDB
Position
15
AA seq 519 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPPEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMAADSIYTASQM
PSRSLLFYDDGAGSWEDGRSALLPMEPPDGWEINPGGPAEQRPQDHLQHDHLDNTHETAK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggaaccattcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggacttcctcaacaatgcgcactttcctgagcacctg
gaccacttcacggagaacatggaggacttctccaatgacctgttcagcagtttctttgat
gaccctgtgctggatgagaagagccctctattggacatggaactggactcccctacgcca
ggcatccaggcggagcacagctactccctgagtggcgactcagcgccccagagccccctt
gtgcccatcaagatggaggacaccacccaagatgtggagcatggagcgtgggcgctggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgccccgtcggccatggctgccgcggccgccatggccaccaccccgctgctgggc
ctcagccccttgtccaggctgcccatcccccaccaggctccaggagagatgactcagctg
ccagtgatcaaagcagagcctccggaggtgaaccagttcctcaaagtgacaccggaggac
ctggtgcagatgcctccgacgcctcccagcagccacggcagtgacagcgacggctcccag
agtccccgctctctgcccccctccagccctgtcaggcccatggcacgctcctccacggcc
atctccacctccccactcctcactgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaagcggaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagccgaggagaaggccttaaagagagtccggaggaaaatcaagaac
aagatctcggcccaggagagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggagacatttacatctgagaacaatgaactgtggaagaaggtagagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctccctcgtgccctgccttcctgagttctcctccggc
tcccagactgtgaaggaagaccccatggccgcagacagcatctacacggccagccagatg
ccctcccgaagcctcctattctacgatgacggggcaggctcatgggaagatggccgcagc
gccctgcttcccatggagcccccagatggctgggaaatcaaccccggggggccggcagag
cagcggccccaggaccacctgcagcatgaccacctggacaacacccacgagaccgccaag
tacctgagtgaggcctggcctaaagacggtggaaacggcaccagccccgacttctcccac
tccaaggagtggttccacgacagggatctgggtcccaacaccaccatcaaactctcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672399
Entry
104672399         CDS       T03989                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104672399 (ATF2)
   04668 TNF signaling pathway
    104672399 (ATF2)
   04022 cGMP-PKG signaling pathway
    104672399 (ATF2)
   04151 PI3K-Akt signaling pathway
    104672399 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104672399 (ATF2)
   04922 Glucagon signaling pathway
    104672399 (ATF2)
   04915 Estrogen signaling pathway
    104672399 (ATF2)
   04926 Relaxin signaling pathway
    104672399 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    104672399 (ATF2)
   04918 Thyroid hormone synthesis
    104672399 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    104672399 (ATF2)
   04925 Aldosterone synthesis and secretion
    104672399 (ATF2)
   04927 Cortisol synthesis and secretion
    104672399 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104672399 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    104672399 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    104672399 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    104672399 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104672399 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    104672399 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    104672399 (ATF2)
   05031 Amphetamine addiction
    104672399 (ATF2)
   05034 Alcoholism
    104672399 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104672399 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104672399 (ATF2)
   05161 Hepatitis B
    104672399 (ATF2)
   05163 Human cytomegalovirus infection
    104672399 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104672399 (ATF2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    104672399 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 104672399
NCBI-ProteinID: XP_010374505
UniProt: A0A2K6P0C5
LinkDB
Position
14
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAIATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcgcctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaaccagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcttca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacctatcataaga
agcaaaattgaggaaccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccacg
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtaccgtaatcacccag
gcaccatcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
atcccgggtccttcctctccccaaccagtacagtcggaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagt
ggattggttaggactcagtcagaggaatctcgaccacagtcattacaacagccagccaca
tccactacagagactccggcttctccagctcacacaactccacagacccaaagtacaagt
ggtcgtcggagaagagcagctaacgaagatcctgatgaaaaaaggagaaagtttttagag
cgaaatagagcagccgcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
atttcagtgccgagtagtccacatacagaagctatacagcatagttcggtcagcacatcc
aatggagtcagttcaacctccaaggcagaagctatagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcacagatcgttatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672444
Entry
104672444         CDS       T03989                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104672444 (CREB3)
   04024 cAMP signaling pathway
    104672444 (CREB3)
   04022 cGMP-PKG signaling pathway
    104672444 (CREB3)
   04151 PI3K-Akt signaling pathway
    104672444 (CREB3)
   04152 AMPK signaling pathway
    104672444 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104672444 (CREB3)
   04922 Glucagon signaling pathway
    104672444 (CREB3)
   04915 Estrogen signaling pathway
    104672444 (CREB3)
   04926 Relaxin signaling pathway
    104672444 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    104672444 (CREB3)
   04918 Thyroid hormone synthesis
    104672444 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    104672444 (CREB3)
   04916 Melanogenesis
    104672444 (CREB3)
   04925 Aldosterone synthesis and secretion
    104672444 (CREB3)
   04927 Cortisol synthesis and secretion
    104672444 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104672444 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104672444 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    104672444 (CREB3)
   04728 Dopaminergic synapse
    104672444 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    104672444 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    104672444 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104672444 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    104672444 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104672444 (CREB3)
   05020 Prion disease
    104672444 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    104672444 (CREB3)
   05031 Amphetamine addiction
    104672444 (CREB3)
   05034 Alcoholism
    104672444 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104672444 (CREB3)
   04934 Cushing syndrome
    104672444 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104672444 (CREB3)
   05161 Hepatitis B
    104672444 (CREB3)
   05163 Human cytomegalovirus infection
    104672444 (CREB3)
   05165 Human papillomavirus infection
    104672444 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104672444 (CREB3)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104672444 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 104672444
NCBI-ProteinID: XP_010374550
UniProt: A0A2K6Q297
LinkDB
Position
16
AA seq 372 aa
MELELDAGDQDLLGFLLEGSGDLGTAPDESVRAPLDWELPLSEVPSDWEIDDLLSSLLSS
PASSLNVLSSSNPCLVHHDHTYSLPREPISMDLESESCRKEGTQMTPQHMEELAEQEIAR
LVLTDEEKSLLEKEGLILPETLPLTKMEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLE
SRVLKYTAQNMELQNKVQLLEEQNLSLLHQLRKLQAMVIEISNKTSSSSTCILVLLVSFC
LLLVPAMYSSDTRGSLPSEHGVLSRQLRALPSENPYQLELPALQSEVPKDSTHQWLDSSD
HVLQAPGNSSCLLYYMPQAPSAEPPLEWPFLDLFSESLCRGPILPLQANLTRKGGWLPTG
SPSVILQDRYSG
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggagctggaattggacgctggtgaccaagacctgctgggctttctgctagagggaagt
ggagatttggggacggcgcccgatgagtccgtgagggccccactggactgggagctgccg
ctttctgaggtaccgagcgactgggagatagatgatttgttgagctccctgctgagttcc
ccagcgtcgtcgttgaacgttctcagctcctccaacccctgccttgtccaccatgaccac
acctactccctcccacgggaacctatctctatggatctagagagtgagagctgtagaaaa
gaggggacccagatgactccacagcatatggaggagctggcagagcaggagattgctagg
ctggtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcctgag
acacttcctctcactaagatggaggaacaaattctgaaacgtgtgcggaggaagattcga
aataaaagatctgctcaagagagccgcaggaaaaagaaggtgtatgttgggggtttagag
agcagggtcttgaaatatacagcccagaatatggagcttcagaacaaagtacagcttctg
gaggaacagaatttgtcccttctacatcaactgaggaaactccaggccatggtgattgag
atatcaaacaaaacgagcagtagcagcacctgcatcttggtcctactagtctccttctgc
ctcctccttgtacctgctatgtactcctctgacacaagggggagcctgccatctgagcat
ggagtgttgtcccgccagcttcgtgccctccccagtgagaacccttaccagctggagttg
cctgccctgcagtcagaggtgccaaaagacagcacacaccagtggctggacagctcagac
cacgtactccaggctcctggcaactcttcctgcctactgtactacatgcctcaggctccc
agtgcagagcctcccctggagtggccattccttgacctcttctcagagtctctctgccga
ggtcccatcctccccctgcaggcaaatctcacaaggaaggggggatggcttcctaccggt
agcccctctgtcatcttgcaggacagatactcaggctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674035
Entry
104674035         CDS       T03989                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104674035 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104674035 (ATF6B)
   04022 cGMP-PKG signaling pathway
    104674035 (ATF6B)
   04151 PI3K-Akt signaling pathway
    104674035 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104674035 (ATF6B)
   04915 Estrogen signaling pathway
    104674035 (ATF6B)
   04926 Relaxin signaling pathway
    104674035 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    104674035 (ATF6B)
   04918 Thyroid hormone synthesis
    104674035 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    104674035 (ATF6B)
   04925 Aldosterone synthesis and secretion
    104674035 (ATF6B)
   04927 Cortisol synthesis and secretion
    104674035 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104674035 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    104674035 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    104674035 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104674035 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    104674035 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    104674035 (ATF6B)
   05031 Amphetamine addiction
    104674035 (ATF6B)
   05034 Alcoholism
    104674035 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104674035 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104674035 (ATF6B)
   05161 Hepatitis B
    104674035 (ATF6B)
   05163 Human cytomegalovirus infection
    104674035 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104674035 (ATF6B)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104674035 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 104674035
NCBI-ProteinID: XP_010376554
LinkDB
Position
4
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGA
SGKALPTRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAACLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDAVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHPPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctgagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctgagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccgtccagatcaacgtagtc
cccacctctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctatccccttcagggtgcctcctgtgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggcgcc
tcagggaaagccctgcccacccggaagccgccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctt
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgcctgtctaccgcggcctgagaggaagagcattgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcccgtctctcctcggatgaacaagggggag
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacagccttccccgggggcaccaaggagctactactgagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgatgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtt
cccatccaaccccctggacccccagaaagggatgctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcgctccgaaagcagccctcccca
accccaggcaatgccacaggcggccccttgccagcctctgcagccagccaggcccatcag
gcctcccacccgcccctctacctcaatcatccctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680220
Entry
104680220         CDS       T03989                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04380  Osteoclast differentiation
rro04612  Antigen processing and presentation
rro04668  TNF signaling pathway
rro04710  Circadian rhythm
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104680220 (CREB1)
   04024 cAMP signaling pathway
    104680220 (CREB1)
   04022 cGMP-PKG signaling pathway
    104680220 (CREB1)
   04151 PI3K-Akt signaling pathway
    104680220 (CREB1)
   04152 AMPK signaling pathway
    104680220 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    104680220 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    104680220 (CREB1)
   04922 Glucagon signaling pathway
    104680220 (CREB1)
   04915 Estrogen signaling pathway
    104680220 (CREB1)
   04926 Relaxin signaling pathway
    104680220 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    104680220 (CREB1)
   04918 Thyroid hormone synthesis
    104680220 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    104680220 (CREB1)
   04916 Melanogenesis
    104680220 (CREB1)
   04924 Renin secretion
    104680220 (CREB1)
   04925 Aldosterone synthesis and secretion
    104680220 (CREB1)
   04927 Cortisol synthesis and secretion
    104680220 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104680220 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104680220 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    104680220 (CREB1)
   04728 Dopaminergic synapse
    104680220 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104680220 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    104680220 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104680220 (CREB1)
   04713 Circadian entrainment
    104680220 (CREB1)
   04714 Thermogenesis
    104680220 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104680220 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104680220 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104680220 (CREB1)
   05020 Prion disease
    104680220 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    104680220 (CREB1)
   05031 Amphetamine addiction
    104680220 (CREB1)
   05034 Alcoholism
    104680220 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104680220 (CREB1)
   04934 Cushing syndrome
    104680220 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104680220 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104680220 (CREB1)
   05161 Hepatitis B
    104680220 (CREB1)
   05163 Human cytomegalovirus infection
    104680220 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680220 (CREB1)
   05165 Human papillomavirus infection
    104680220 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104680220 (CREB1)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104680220 (CREB1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104680220 (CREB1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    104680220 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 104680220
NCBI-ProteinID: XP_010384370
UniProt: A0A2K6Q2B5
LinkDB
Position
14
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctccaactgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcttacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagacc
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681895
Entry
104681895         CDS       T03989                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104681895 (CREB5)
   04024 cAMP signaling pathway
    104681895 (CREB5)
   04022 cGMP-PKG signaling pathway
    104681895 (CREB5)
   04151 PI3K-Akt signaling pathway
    104681895 (CREB5)
   04152 AMPK signaling pathway
    104681895 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104681895 (CREB5)
   04922 Glucagon signaling pathway
    104681895 (CREB5)
   04915 Estrogen signaling pathway
    104681895 (CREB5)
   04926 Relaxin signaling pathway
    104681895 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    104681895 (CREB5)
   04918 Thyroid hormone synthesis
    104681895 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    104681895 (CREB5)
   04925 Aldosterone synthesis and secretion
    104681895 (CREB5)
   04927 Cortisol synthesis and secretion
    104681895 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104681895 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104681895 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    104681895 (CREB5)
   04728 Dopaminergic synapse
    104681895 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    104681895 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    104681895 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104681895 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    104681895 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104681895 (CREB5)
   05020 Prion disease
    104681895 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    104681895 (CREB5)
   05031 Amphetamine addiction
    104681895 (CREB5)
   05034 Alcoholism
    104681895 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104681895 (CREB5)
   04934 Cushing syndrome
    104681895 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104681895 (CREB5)
   05161 Hepatitis B
    104681895 (CREB5)
   05163 Human cytomegalovirus infection
    104681895 (CREB5)
   05165 Human papillomavirus infection
    104681895 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104681895 (CREB5)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    104681895 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 104681895
NCBI-ProteinID: XP_010386628
LinkDB
Position
6
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSE
VVGSSTLSQLTTHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgcttc
ccaacagaggaccatctgatgattcataggcacaaacatgaaatgactttgaagtttcct
tcaataaaaacagacaatatgttatcagatcaaactccaaccccaacgagattcctgaag
aactgcgaagaggtgggcctcttcagcgagcttgactgctccctggagcatgagttcagg
aaggcccaggaggaggagagcagcaagcggaatatctcaatgcataatgcagttggtggg
gccatgacagggcccggaactcaccagcttagcagtgctcggctgcccaaccacgacacc
agcgttgtgattcagcaagccatgccgtcgccccagtccagctccgtcatcacccaggca
ccttccaccaaccgccagattgggcctgtcccaggctctctatcttctctgctacatctc
cacaacagacagagacagcccatgccagcctccatgcctgggaccctgcccaaccccaca
atgccaggatcttccgccgtcttgatgccaatggagagacaaatgtcagtgaactccagc
atcatggggatgcaaggtccaaatctcagcaacccctgtgcttctccccaggtccagcca
atgcattcagaagccaaaatgaggttgaaggctgcattgactcaccaccctgctgccatg
tcaaatgggaacatgaacaccatgggacacatgatggagatgatgggctcccggcaggac
cagacgccacaccatcacatgcactcgcacccacatcagcaccagacactgccaccccac
cacccttacccacaccagcaccagcacccagcgcaccatcctcaccctcaaccccatcac
cagcagaatcatccacatcaccactcccattcccaccttcatgcacacccagcacatcac
cagacctcgccacatccgcccctgcacaccggcaaccaagcacaggtttcaccagcaaca
caacagatgcagccaacccagacaatacagccaccccagcccacaggggggcgccggcga
agggtggtggacgaggatcccgacgagaggcggcggaaatttctggaacggaaccgggca
gctgccacccgctgcagacagaagaggaaggtctgggtgatgtcattggaaaagaaagca
gaagaactcacccagacaaacatgcagcttcagaatgaagtgtctatgttgaaaaatgag
gtggcccagctgaaacagttgttgttaacacataaagactgcccaataacagccatgcag
aaagaatcacaaggatatctaagtccggagagtagccctcctgctagtcctgtcccagct
tgctcccagcaacaagtcatccagcataataccatcactacttcctcatcagtcagcgag
gtggtaggaagctccaccctcagccagctcaccactcacagaacagacctgaatccaatt
ctttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682563
Entry
104682563         CDS       T03989                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04137  Mitophagy - animal
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04932  Non-alcoholic fatty liver disease
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104682563 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104682563 (ATF4)
   04668 TNF signaling pathway
    104682563 (ATF4)
   04022 cGMP-PKG signaling pathway
    104682563 (ATF4)
   04151 PI3K-Akt signaling pathway
    104682563 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104682563 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    104682563 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104682563 (ATF4)
   04922 Glucagon signaling pathway
    104682563 (ATF4)
   04912 GnRH signaling pathway
    104682563 (ATF4)
   04915 Estrogen signaling pathway
    104682563 (ATF4)
   04926 Relaxin signaling pathway
    104682563 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    104682563 (ATF4)
   04918 Thyroid hormone synthesis
    104682563 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    104682563 (ATF4)
   04925 Aldosterone synthesis and secretion
    104682563 (ATF4)
   04927 Cortisol synthesis and secretion
    104682563 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104682563 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    104682563 (ATF4)
   04728 Dopaminergic synapse
    104682563 (ATF4)
   04720 Long-term potentiation
    104682563 (ATF4)
   04722 Neurotrophin signaling pathway
    104682563 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    104682563 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104682563 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    104682563 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104682563 (ATF4)
   05012 Parkinson disease
    104682563 (ATF4)
   05014 Amyotrophic lateral sclerosis
    104682563 (ATF4)
   05020 Prion disease
    104682563 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    104682563 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    104682563 (ATF4)
   05031 Amphetamine addiction
    104682563 (ATF4)
   05034 Alcoholism
    104682563 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104682563 (ATF4)
   04934 Cushing syndrome
    104682563 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104682563 (ATF4)
   05161 Hepatitis B
    104682563 (ATF4)
   05163 Human cytomegalovirus infection
    104682563 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104682563 (ATF4)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    104682563 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4795 AAA_13 Laminin_II Nop53 DUF4407 Fez1 bZIP_Maf
Other DBs
NCBI-GeneID: 104682563
NCBI-ProteinID: XP_010387584
UniProt: A0A2K6NSY5
LinkDB
Position
13
AA seq 351 aa
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVEGLVSPSNNGKEDAFSGTDWMLEKMDLKEFDFDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKEPPQTVNPIGHLPESLTKPDQVAPFTFLQPLSLFPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDSTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVETKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggaggggttggtcagtccctctaacaacggcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgactttgatgccctgttg
ggtatagatgacctggaaaccatgccagatgaccttttgaccacgttggatgacacgtgt
gatctctttgcccccctagtccaggagactaacaaggagcccccccagacagtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttcttg
caacctctttcccttttcccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatcactgaaggagataggaagccagactccactgcttat
gttgccatgatccctcagtgcataaaggaggaagacaccccctcagataatgatagtggc
atctgtatgagcccagagtcctatctgggctctcctcagcatagcccctctaccaggggc
tctccaaataggagcctcccatctccaggtgttctgtgtggttctgcccgccccaaacct
tacgaccctcctggagagaagatggtagaaacaaaagtaaagggtgagaaactggataag
aagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcggagcaggaggctctcactggcgagtgcaaagagctggaaaagaagaatgaggctctg
aaagagagggcggattccctagccaaggagatccagtacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system