KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656977
Entry
104656977         CDS       T03989                                 

Gene name
TAS2R1
Definition
(RefSeq) taste receptor type 2 member 1
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104656977 (TAS2R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104656977 (TAS2R1)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104656977 (TAS2R1)
SSDB
Motif
Pfam: TAS2R OPA3
Other DBs
NCBI-GeneID: 104656977
NCBI-ProteinID: XP_010354998
LinkDB
Position
3
AA seq 299 aa
MLESHLIIYFLLAVIQFLFGTFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLVVSRIFLQL
FIFYINVVVIFLMEFITCSANCVFLIFVNELELWLATWLGVFYCAKVASVPHPLFIWLKM
RISKLVPWMILGSLLYVSMICIFHSKYTGFMDPYFLRNFFFQNATIQTEVKQRIQVFSFV
AELLVPLLIFLVAVLLLIFSLGRHSRQMRNTVAGSSVPGRSAHISALLSILSFLILYISH
CLIKAFLSSLKFHVKRSIFLFFILVIGTYPSGHSLILILGNPKLKQNTKKFLCHSKCCQ
NT seq 900 nt   +upstreamnt  +downstreamnt
atgctagagtcacacctgattatctattttcttcttgcagtgatacaatttctttttggg
actttcacaaatggcataattgtggtggtgaatggcattgacttgatcaagcacagaaaa
atggctccgctggatcttcttctttcttgcctggtggtttctagaatttttctgcagttg
ttcatcttctacattaatgtggttgttatcttcttgatggaattcatcacgtgttctgcg
aattgtgtatttctcatatttgtaaatgaattggaactttggcttgccacatggctcggc
gttttctactgtgccaaggttgccagcgtccctcacccactcttcatctggttgaagatg
aggatatccaagttagtcccgtggatgatcctggggtctctgctatatgtatctatgatt
tgtattttccatagcaaatatacagggtttatggacccatacttcttaagaaactttttc
ttccaaaatgccacaattcaaacagaagttaaacagcgtatacaggttttctcttttgtt
gctgagctcttagtgccattacttatcttccttgttgctgttctgctcttgattttctct
ctggggaggcactcccggcaaatgagaaacacagtggctggcagcagtgttcctggcagg
agtgcccacatcagcgcgttgctgtccatcctgtccttcctgatcctctacatctcccac
tgcttgataaaagcttttctctcttctctaaagtttcatgtcaaaaggtccatctttctg
ttcttcatccttgtgattggtacatacccttccggacactctctcatcttaattttagga
aatcctaaattgaaacaaaatacaaaaaagttcctctgccacagtaagtgctgtcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659339
Entry
104659339         CDS       T03989                                 

Gene name
TAS2R14
Definition
(RefSeq) taste receptor type 2 member 14
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104659339 (TAS2R14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104659339 (TAS2R14)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104659339 (TAS2R14)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104659339
NCBI-ProteinID: XP_010357740
UniProt: A0A2K6NQ21
LinkDB
Position
10
AA seq 319 aa
MDGVIKSIFTFILIVEFIIGNAGNSFIVLVNCIDWVKRRTISLVDQILIALAISRISLVW
LIFGSWCVSVFFPALFATEKMLRMLTNIWTVTNHFSVWLAASLGTFYFLKIANFSNSIFL
YLKWRVKKVVLVLLLVTLVLLFLNILLINIHINASINGYRGNMTCSSASCNFTRFSSVIA
LTSTVFILIPFILSLATFLLLTFSLWKHHKKMQHTVKGSRDASTEAHSGVMKTVITFLLL
YSIFFLTFFMSVWISERLEENLIIILSEMMGMAYPSGHSCFLILGNKKLRQASLSVLWWL
RYRFKDGEPSGHREFRESS
NT seq 960 nt   +upstreamnt  +downstreamnt
atggatggtgtcataaagagcatatttacattcattttaattgtggaatttatcattgga
aatgcaggaaatagtttcatagttctggtgaactgtattgactgggtcaaaagaagaacg
atctctttagttgatcagattctcattgctttggcaatctctagaattagtctggtttgg
ttaatatttggaagctggtgtgtatctgtgtttttcccagctttatttgccactgaaaaa
atgttaagaatgcttactaatatctggacagtgaccaatcattttagtgtctggttagct
gcaagtctaggtactttttattttctcaagatagccaatttttctaactctatttttctc
tacctaaagtggagagttaaaaaggtggttttagtgctgcttcttgtgactttggtcctc
ttgtttttaaatattttactgataaacattcatataaatgccagtatcaatggatacaga
ggaaacatgacttgcagttctgcttcatgtaactttacacgattttccagtgttattgca
ttaaccagcactgtgttcattttaattccctttattttgtccctggcaacttttcttctg
ctcaccttctccctgtggaaacatcacaagaagatgcagcacactgtcaaaggatccaga
gacgccagcaccgaggcccacagtggagttatgaaaactgtgatcactttcctcctactc
tattccattttctttctgacttttttcatgtcagtttggatctctgaacggttggaggaa
aatctaattattattctttctgagatgatgggaatggcttatccttcaggtcactcatgt
tttctgattcttggaaacaagaagctgagacaggcctctctgtcagtgctatggtggctg
aggtacaggtttaaagatggggagccctcaggtcacagagaatttagggaatcatcttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659710
Entry
104659710         CDS       T03989                                 

Gene name
TAS2R3
Definition
(RefSeq) taste receptor type 2 member 3
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104659710 (TAS2R3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104659710 (TAS2R3)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104659710 (TAS2R3)
SSDB
Motif
Pfam: TAS2R 7tm_1 HCV_NS2
Other DBs
NCBI-GeneID: 104659710
NCBI-ProteinID: XP_010358124
LinkDB
Position
6
AA seq 316 aa
MMGLTEGVFLIVCGTQFTLGILVNGFIGLVNGRSWFKTKRMSLSDFIIATLALSRIILLC
IILTDSFLIVFSVNEHDSGIIMQIIDVFWTFTNHLSIWFATCLGVLYCLKIASFSHPTFL
WLKWRVSRVLVWMLLGALLLSCGSTTSLINEFKLYSVLRGTEATRNVTEHFRKKRNEYYL
IHVLGTLWYLPPLIVSLASYFLLIFSLGRHTRQMLQNSTSSREPSTEAHKRAIRIILSFF
FLFLLYFLAFLIASFGHFLPKTKMAKMIGEVMTMFYPAGHSFIVILGNSKLKQTFVQMFQ
CESGHLKPGSKGPIFS
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatgggactcaccgagggggtgttcctgattgtgtgtggcactcagttcacactggga
attctggtcaatggtttcattggtttggtcaatggtaggagctggttcaagaccaagaga
atgtctttgtctgacttcatcattgccaccctggcactctcgaggatcattctgctgtgt
attatcttgactgatagttttttaatagtattctctgtcaacgaacatgattcagggata
ataatgcaaattattgatgttttctggacatttacaaaccatctgagcatttggtttgcc
acttgtcttggtgtcctctactgcttgaaaattgccagtttctctcaccccacattcctc
tggctcaagtggagagtttctagggtgctggtatggatgctgttgggtgcactgctctta
tcctgtggtagtaccacatctctgatcaatgagtttaagctctattctgtccttagggga
actgaggccaccaggaatgtgactgaacacttcagaaagaagaggaatgagtattatctg
atccatgttcttgggactctgtggtacctgcctcccttaattgtgtccctggcctcctac
tttttgctcatcttctccttggggaggcacacacggcagatgctgcaaaatagtacaagc
tccagagaaccaagcactgaggcccacaagagggccatcagaatcatcctttccttcttc
tttctcttcttactttactttcttgcctttttaattgcatcatttggtcatttcctacca
aaaaccaagatggctaagatgattggcgaagtaatgacaatgttttatcctgctggccac
tcatttattgtcattctggggaacagcaaactgaagcagacatttgtacagatgttccag
tgtgagtctggccacctgaagcctggatccaagggacccattttctcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659711
Entry
104659711         CDS       T03989                                 

Gene name
TAS2R4
Definition
(RefSeq) taste receptor type 2 member 4
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104659711 (TAS2R4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104659711 (TAS2R4)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104659711 (TAS2R4)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104659711
NCBI-ProteinID: XP_010358125
LinkDB
Position
6
AA seq 299 aa
MLWLFYFSATIASVILNFVGIIVSLFITVVNYKTWVKSHRISSSERILFSLSITRFLMLG
LFLVNTIYLVSSNKERSVYLSVFFVLCFMFLDSSSLWFVTLLNSLYCVKITNFQHSVFLL
LKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPALVTERNNTSFNISDGILSLVVS
FVLSSSLQFIINVTSASLLIYSLRRHIQKMQKNATGFWNPQMEAHVGAMKLMIYFLILYI
PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTAAKKILCFKK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgctttggttattctatttctctgctactattgcctcagttattttaaattttgtagga
atcattgtgagtctgtttattacagtggtcaattataaaacttgggtcaaaagccataga
atctcctcttctgaaaggatcctgttcagcttgagcatcaccaggtttcttatgctggga
ctatttctggtgaacaccatctatttagtctcttcaaataaggaaaggtcagtctacctg
tctgttttttttgtgttgtgtttcatgtttttggactcaagcagtctctggtttgtgacc
ttgctcaacagcttgtactgtgtgaagattaccaacttccaacactcagtgtttctcctg
ctgaagcggaatatctccccaaagattcccagactgctgctggcctgtgtgctgatttct
gctttcaccacttgcctgtatatcacgcttagccaggcatcaccttttcctgcacttgtg
actgagagaaataacacatcatttaatatcagtgacggcatcttgtctttagtggtttct
tttgtcttgagctcatctctccagttcatcattaatgtgacttctgcttccttgctaata
tactccttgaggagacacatacagaagatgcagaaaaatgccactggtttctggaatccc
cagatggaagctcatgtaggtgctatgaagctgatgatctatttcctcatcctctacatt
ccatattcagttgctacactggtccagtatctccccttttatgcagggatggatatgggg
accaaatccatttgtctgatttttgccaccctttactctccaggacattctgttctcatt
attatcacacatcctaaactgaaaacagcagcaaagaagattctttgtttcaaaaaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659712
Entry
104659712         CDS       T03989                                 

Gene name
TAS2R5
Definition
(RefSeq) taste receptor type 2 member 5
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104659712 (TAS2R5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104659712 (TAS2R5)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104659712 (TAS2R5)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104659712
NCBI-ProteinID: XP_010358126
UniProt: A0A2K6NKA7
LinkDB
Position
6
AA seq 299 aa
MLSAGLGLLMLVAVIEFLIGLIGNGVLVVWSFREWIRKFSWSSYNLIILGLAGCRFLLQW
LIILDLSLFPLFQSSRWLRYLSVFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ
RACNLSLWCLLGYFIINLLLTVKFGLTVHHPPQGNSSIRYPFEHWQYLYVFQLNSGSYLP
LVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDARAKAHITALKSLGCFLLLHLVYIVASPF
SITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVKQTCQKILWKTVCARRCWGP
NT seq 900 nt   +upstreamnt  +downstreamnt
atgctgagcgctggcctaggactgctgatgctggtggccgtgattgaatttctcatcggt
ttaattggaaacggagtccttgtggtctggagttttagagaatggatcagaaaattcagc
tggtcctcatataacctcattatcttgggcctggctggctgccggtttctcctgcagtgg
ctgatcattttggacttaagcttgtttccacttttccagagcagccgttggctccgctac
cttagtgtcttctgggtcctggtaagccaggccagcttgtggtttgccaccttcctcagt
gtcttctattgcaagaagatcaccacctttgatcgccctgcctacttgtggctgaagcag
agggcctgtaacctgagtctctggtgccttctgggctactttataatcaatttgttactt
acagtcaaatttggcttaacggtccatcatcctccccaaggaaacagcagcattcgttat
ccctttgaacactggcagtacctgtatgtatttcagctcaattctggaagttatttgcct
ttagtggtgtttcttgtttcctctgggatgctgattgtctctttgtatacacaccacaag
aagatgaaggtccattcagctggtaggagggatgcccgggccaaggctcacatcactgcc
ctgaagtccttgggctgcttcctcttacttcacctggtttatatcgtggccagccccttc
tccatcacctccaagacttatcctcctgatctcaccagtgtcttcatctgggagacactc
atggcggcctatccttctcttcattctctcatattgatcatggggattcctagggtgaag
cagacttgtcagaagatcctgtggaagacagtgtgtgctcggagatgctggggcccatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659718
Entry
104659718         CDS       T03989                                 

Gene name
TAS2R38
Definition
(RefSeq) taste receptor type 2 member 38
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104659718 (TAS2R38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104659718 (TAS2R38)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104659718 (TAS2R38)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104659718
NCBI-ProteinID: XP_010358135
LinkDB
Position
6
AA seq 333 aa
MLTLTHICTVSYEVRSTFLFISVLEFAVGFLTNAFIFLVNFWDIVKRQPLSNSDCVLLCL
SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYEAILMLWMIANQANLWLATCLSLLYCSK
LIRFSHTFLICLASWVSRKISQMLLGIFLCSCICTVLCVWCFFSRLHFTVTTVLFMNNNT
RLNWQIKDLNLFYSFLFCCLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDSRDPSLE
AHMKALKSLISFFCFFVISSCAAFISVPLLILWHDKIGVMVCVGIMAACPSGHAAVLISG
NAKLRRAVTTILLWAESSLKVRADHMADSKTLC
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgttgactctaactcacatctgcactgtgtcctatgaagtcaggagcacatttctgttc
atttcagtcctggagtttgcagtggggtttctaaccaacgccttcattttcttggtgaat
ttttgggacatagtgaagaggcagccactgagcaacagtgattgtgtgcttctgtgtctc
agcatcagccggcttttcctgcatggactgctcttcctgagtgctatccagcttacccac
ttccagaagttgagtgaaccactgaaccacagctacgaagccatcctcatgctatggatg
attgcaaaccaagccaacctctggcttgccacctgcctcagcctactctactgctccaag
ctcatccgtttctctcacaccttcctgatctgcttggcaagctgggtctccaggaagatc
tcccagatgctcctgggtatttttctttgctcctgcatctgcactgtcctctgtgtttgg
tgcttttttagcagacttcacttcacagtcacaactgtgctattcatgaataacaataca
aggctcaactggcagattaaagatctcaacttattttattcctttctcttctgctgtctg
tggtctgtccctcctttcctattgtttctagtttcttctgggatgctgactgtctccctt
ggaaggcacatgaggacaatgaaggtctatactagagactctcgtgaccccagcctggag
gcccacatgaaagccctcaagtctcttatctcatttttctgcttctttgtgatatcatcc
tgtgctgccttcatctcagtgcccctacttattctgtggcatgacaaaataggggtgatg
gtttgtgttgggataatggcagcttgtccctctgggcatgcagctgtcctgatctcaggc
aatgccaagttgaggagagctgtgacaaccattctgctctgggctgagagcagcctgaag
gtaagagccgaccacatggcagattccaagacactgtgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666001
Entry
104666001         CDS       T03989                                 

Gene name
TAS2R16
Definition
(RefSeq) taste receptor type 2 member 16
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104666001 (TAS2R16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104666001 (TAS2R16)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104666001 (TAS2R16)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104666001
NCBI-ProteinID: XP_010366279
LinkDB
Position
6
AA seq 291 aa
MIPIQLSVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ
WTSMLNDFCFYFNFNYVLCNLTITWEFFNVLTFWLNSLLTVFCCIKVSSFTHPIVLWLRW
RILRLLPRLLLGSLMITFVTIIPSAIGNYIQIQFLTMEHPPRNSTVIDRLQKLHQYLLQA
HIVALVVPFILFLASTILLMASLTKQIQHHGTGHCNPSMKAHFTALRSLAILFIVFTSYF
LTILITMIGTLFDKRCWLWVWEAFVYAFIFMHSTSLMLSSPTLKRILSGKC
NT seq 876 nt   +upstreamnt  +downstreamnt
atgatacccatccaactcagtgtcttcttcatgatcatctatgtgcttgagtccttgaca
attattgtgcagagcagcttaattgttgcagtgctgggcagagaatggctgcaagtcaga
aggctgatgcctgtggacatgattctcatcagcctgggcatctctcgcttctgtctacag
tggacatcaatgctgaacgatttttgcttctattttaattttaattatgttctttgcaac
ttaacaatcacctgggaattttttaatgtccttacattctggttaaacagcttgcttacc
gtcttctgctgcatcaaggtctcttctttcacccatcccatcgttctctggctgaggtgg
agaattttgaggttgcttccccggctattactgggttctctgatgattacttttgtgaca
atcatcccttcagctattgggaattacattcaaattcagtttctcaccatggagcatcca
cccagaaacagcactgtaattgacagacttcaaaagcttcatcagtatctgctccaggct
catatagtcgcgttggttgttcctttcatcctgttcctggcctccaccatcttgctcatg
gcatcactgaccaagcagatacaacatcatggcactggtcactgcaatccaagcatgaaa
gcacacttcactgccctgaggtcccttgccatcttgtttatcgtgtttacctcttacttt
ctaaccatacttatcacgatgataggtactctatttgataagagatgttggttatgggtc
tgggaagcttttgtctatgctttcatctttatgcattccacttcactgatgctgagcagc
cctacattgaaaaggattctaagtggaaaatgctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668633
Entry
104668633         CDS       T03989                                 

Gene name
TAS2R7
Definition
(RefSeq) taste receptor type 2 member 7
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104668633 (TAS2R7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104668633 (TAS2R7)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104668633 (TAS2R7)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104668633
NCBI-ProteinID: XP_010369697
LinkDB
Position
10
AA seq 318 aa
MTDKVQTTLFFLAIGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC
VILLDCFMLVLYPDVYATGKQMRIIDFFWTLTNHLSIWFATCLSIYYFFKIATFFHPLFL
WMKWRIDRVISWILLGCVVLSVFINLPATENLNADFRRCVKAKRKTNLTWSCRVNKAQHA
STKLFLNLVTLLPFSVCLMSFFLLILSLRRHIRRMQLGATGCRDPSREAHVRALKAVISF
LLLFIAYYLSFLIATSSYFIPETELAVIFGEFIALIYPSSHSFILILGNNKLRRASLKVL
WTVMSILKGRKFQQHKQI
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacagataaagtacaaactactttattcttcttagcaattggagagttttcagtgggg
atcttagggaatgcattcattggattggtaaactgtatggactgggtcaagaagaggaaa
attgcctccattgatttaatcctcacaagtctggccatttccagaatttgtctattatgc
gtaatactattagattgttttatgttggtgctgtatccagatgtctatgccactggtaaa
caaatgagaatcattgacttcttctggacactaaccaaccatttaagcatctggtttgca
acctgcctcagcatttactatttcttcaagatagctactttctttcacccacttttcctc
tggatgaaatggagaattgacagggtgatttcctggattctattggggtgcgtggttctc
tctgtgtttattaaccttccagccactgagaatctgaatgctgatttcaggcgttgtgtg
aaggcaaagaggaaaacaaacttaacttggagttgcagagtaaataaggctcaacatgct
tctaccaagttatttctcaacctggtaacgctgctccccttttctgtgtgcctgatgtca
tttttcctcttgatcctctccctgcggagacatatcaggcgaatgcagctcggtgccaca
gggtgcagagaccccagcagagaagcccatgtgagagccctgaaagctgtcatttccttc
cttctcctctttattgcctactatttgtcctttctcatcgccacctccagctactttatt
ccagagacggaattagctgtgatttttggtgagtttatagctctaatctacccctcaagc
cattcatttatcctaatactggggaacaataaattaagacgcgcatctctaaaggtgctt
tggacagtaatgtctattctaaaaggaagaaaattccaacaacataaacagatctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668634
Entry
104668634         CDS       T03989                                 

Gene name
TAS2R8
Definition
(RefSeq) taste receptor type 2 member 8
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104668634 (TAS2R8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104668634 (TAS2R8)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104668634 (TAS2R8)
SSDB
Motif
Pfam: TAS2R 7tm_1
Other DBs
NCBI-GeneID: 104668634
NCBI-ProteinID: XP_010369698
LinkDB
Position
10
AA seq 309 aa
MFSPADNIFIILITGEFIIGILGNGYIGLVNWIDWIKKKKISTIDCILTNLVISRICLIS
VMVVNGIVIVLYPDVYTKSKLQIVICTFWTFANYLNMWFTACLNVFYFLKVANSSHPLFL
WLKWKIDMVVRWILLGCFAISLLVSLIIATVLSHDYRFHAIAKHKRNVTEMFHVSKMPYF
EHLTLFNLLAIVPFIVSLMSFFLLVRSLRRHTKQIKLYATGGRDPSTEAHVRAIKTMTLL
IFFFFLYYITSLLVNFSYLITNYKLAMAFGEIVAILYPSGHSLILVILNNKLRQASVRML
TCRKIACMV
NT seq 930 nt   +upstreamnt  +downstreamnt
atgttcagtcctgcagataacatctttataatcctaataactggagaattcataatagga
atattggggaatggatacattggactagtcaactggattgactggattaagaagaaaaag
atctctacaattgactgcatcctcaccaatttagttatctccagaatttgtttgatcagt
gtaatggttgtaaatggcattgtaatagtactttacccagatgtttatacaaaaagtaaa
ctacagatagtcatttgtaccttctggacatttgccaactacttaaatatgtggtttacc
gcctgccttaatgtcttctattttctcaaggtagccaattcctctcacccactttttctc
tggctgaagtggaaaattgatatggtggttcgctggatcctgttgggatgttttgccatt
tccttgctggtcagccttataatagcaacagtactgagtcatgattataggtttcatgca
attgccaaacataaaagaaacgttactgaaatgttccatgtgagtaaaatgccatatttt
gaacacttgactctctttaacttgcttgcaattgtcccatttattgtgtcattgatgtca
tttttccttttagtaagatctttacggagacataccaagcaaataaaactctatgctact
ggcggtagagacccaagcacagaagctcatgtgagagccattaaaactatgactttgctt
atcttcttttttttcctatactatattacttcgcttttggtgaactttagctatcttatt
acaaactacaagttagctatggcgtttggagagattgtagcaattctctatccctcgggt
cactcacttattttagttattttaaataacaaactgaggcaggcatctgtcagaatgctg
acgtgtagaaaaattgcctgcatggtatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668635
Entry
104668635         CDS       T03989                                 

Gene name
TAS2R10
Definition
(RefSeq) taste receptor type 2 member 10
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104668635 (TAS2R10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104668635 (TAS2R10)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104668635 (TAS2R10)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104668635
NCBI-ProteinID: XP_010369699
LinkDB
Position
10
AA seq 307 aa
MLSVVEGILIFVVISESAFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI
IITDGFIQIFSPDIYASGKLIECISYFWVISNQSSIWFTTSLSIFYFLKIANFSNYIFLW
LKSRTNRILPLLMGFLLISCLLNFAYIAKILNDLKMKNGTVWRLNMYKREYFIKQILLNL
GVIFFFTLSLITSVLLIISLWRHNRQMQSNVTGLRDSITEAHVKAMKVLISFIILFILYF
IGTAIEISYFTVPENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK
TKNLRAT
NT seq 924 nt   +upstreamnt  +downstreamnt
atgctaagtgtagtggaaggcatcctcatttttgttgtaattagtgagtcagcatttggg
gttttagggaatggatttattggacttgtaaactgcattgactgtgccaagaataagtta
tctacaattggctttattctcaccggcttagctatttctagaatttttctgatatggata
ataattacagatggattcatacagatattctctccagatatatatgcctctggtaagcta
attgaatgtattagttacttttgggtaattagtaatcaatcaagtatatggtttaccacc
agcctcagcatcttctatttcctgaagatagcaaatttttccaactacatatttctctgg
ttgaagagtagaacaaataggattcttccccttctgatgggattcttacttatttcatgc
ttacttaattttgcatatattgcgaagattcttaatgatcttaaaatgaagaatggcaca
gtctggcgtctcaacatgtataaacgtgaatactttattaaacagattttgctaaatctg
ggagtcattttcttctttactctatccctaattacaagtgttttgctgatcatttccctt
tggagacacaacaggcagatgcaatcgaatgtgacaggactgagagactccatcactgaa
gctcatgtgaaggcaatgaaagttttaatatcttttatcatcctctttatcttgtatttt
ataggcacagccatagaaatatcatattttactgtgccagaaaacaaactgttgcttatg
tttggaatgacaaccacagccatctatccctggggtcactcatttatcttaattctagga
aacagcaagctaaagcaagcctctttgagggtactacagcaattgaagtgctgtgagaaa
acgaaaaatctcagagccacatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672858
Entry
104672858         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 50
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104672858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104672858
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104672858
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104672858
NCBI-ProteinID: XP_010375037
UniProt: A0A2K6NGL1
LinkDB
Position
10
AA seq 299 aa
MIPFLHIFFPVLTLILFVLGNFANGFIALVNFIDWVKRKKISLADQILTALAVSRVGLLW
ALLLNWYLTQLNPAFYSVQLRITSYNAWVVTHHFSMWLAASLSVFYLLKIANFSNLIFLH
LKRRVRSIILVILLGALSFLVCHLLVVNMDENMWTEEYEGNMTGKMKLRNAAHLSYMTVT
TLWSFIPFMLSLISFLMLIFSLCKHLKKMQLHCEGSRDPSTTVHLKALQTLISFLLSWAI
FFLFLIVSVWSPRKLQNEPVFMVCKAVGNIYLSFDSFILIWRTKKLKHIFLLILCQIRC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgataccttttctacacattttttttccagttctaacattgattttatttgttcttgga
aattttgccaatggcttcatagcactggtaaatttcattgactgggtgaaaagaaaaaag
atctccttggctgaccaaattctcactgctctggcggtctccagagttggtttgctctgg
gcattattattaaattggtatttaactcagttgaatccagctttttatagtgtacagtta
agaattacttcttataatgcctgggttgtaacccaccatttcagcatgtggcttgctgct
agcctcagcgtattttatttgctcaagattgccaatttctccaaccttatttttcttcat
ttaaagaggagagttaggagtatcattctggtaatactgttgggggctttgtcatttttg
gtttgtcatcttcttgtggtaaacatggatgagaatatgtggacagaagaatatgaagga
aacatgaccgggaagatgaaattgaggaatgcagcacacctttcgtatatgactgtaact
accctgtggagcttcataccctttatgctgtccctgatatcttttctgatgctaatcttt
tctctgtgtaaacatctcaagaagatgcagctccattgtgaaggatctcgagatcccagc
accacggtccacctaaaagctttgcaaactctgatctccttcctcctgtcatgggccatt
ttctttctattcctaatcgtttccgtttggagtcctaggaagctgcagaatgaaccagtt
ttcatggtttgcaaggctgttggaaacatatatctttctttcgactcattcatcctaatt
tggagaaccaagaagctaaaacacatctttcttttgattttgtgtcagattaggtgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672859
Entry
104672859         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 20
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104672859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104672859
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104672859
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104672859
NCBI-ProteinID: XP_010375038
UniProt: A0A2K6NQZ3
LinkDB
Position
10
AA seq 309 aa
MMSFLHIVFSILVVVALLLGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRAGLLW
VIVLHWYSTVLNPTSSSLKVTIFISNAWAVTNHFSNWLATSLSIFYLLKIVNFSRLIFHH
LKRKAKSVVLVIVLGASLFLVCDLVMENMYINVWTKEYERNITWKIKLRNATYLSNLIAV
TVANLIPFTLTLISFLLLICSLCKHLKKMKRYGKGSQDPSTKIHLKALQTVTSFLILFAV
YFLCVIISLWNYKKQQKELVLILCQAVGIIYPTFHSFILIWGNKKLKQSFLSILWQVNCW
AKGQNLSTP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgatgagttttctacacattgttttttccattctagtagtggttgcattgcttcttgga
aattttgccaatggctttatagcactgataaatttcattgcctgggtcaagagacaaaag
atctcctcagctgatcaaattattgctgctctggcagtctccagagctggtttgctctgg
gtaatagtcttacactggtattcaactgtgttgaatccaacttcatctagtttaaaagta
acaatttttatttctaatgcctgggcagtcaccaaccatttcagcaactggcttgctact
agcctcagcatattttatttgctcaagatcgtcaatttctccagacttatttttcatcac
ttaaaaaggaaggctaagagtgtagttctggtgatagtgttgggggcttcgttatttttg
gtttgtgatcttgtgatggaaaacatgtatataaatgtgtggacaaaagaatatgaaaga
aacataacttggaagatcaaattgaggaatgcaacgtacctttctaacttgattgcggtc
acggtagcaaacttgataccattcactctgaccctgatatcttttctgctgttaatctgc
tctctgtgtaaacatctgaagaagatgaagcgctatggcaaaggatctcaagatcctagc
accaaaatccacctaaaagctctgcaaactgtgacctccttcctcatattatttgccgtt
tactttctatgtgtaatcatatcgctttggaattacaagaagcaacagaaagaacttgtc
ttaatcctttgccaagctgttggaatcatatatccaacattccactcattcattctgatt
tgggggaacaagaagctaaagcagagctttctttcaattttgtggcaggtgaattgctgg
gccaaaggacagaacctgtcaactccatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674186
Entry
104674186         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 43
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674186
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674186
SSDB
Motif
Pfam: TAS2R PAG
Other DBs
NCBI-GeneID: 104674186
NCBI-ProteinID: XP_010376748
LinkDB
Position
10
AA seq 308 aa
MITFLPIIFSILVVVTFVIGNFANGFIALVNSIEWVKKQKISFADQILTALAVSRVGLLW
ILLLNWYSTELNPAFYRVEVRTTTYNLWTVTSHFSNWLVTSLSIFYLLKIANFSNLIFLH
LKRRVKSVVLVILLGPLLFLVCHLFVVNMNEIVRTKEYEGNMTWKSKLRSAVYLSNTTVT
MLANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPGTKVHIKALQTVISLSLCAIY
FLSIMISSWSLGRVENKAVFMFCKAIRFSYPSAHAFVLIWGNKKLKQTLLSVLWNVRYWV
KGQKLQSP
NT seq 927 nt   +upstreamnt  +downstreamnt
atgataacttttctacccatcattttttccattctagtagtggttacatttgttattgga
aattttgctaatggcttcatagcattggtaaattccattgagtgggtcaagaaacaaaag
atctcctttgctgaccaaattctcactgctctggcggtctccagagttggtttgctttgg
atattattattaaattggtattcaactgagttgaatccagctttttatagggtagaagta
agaactactacttataatctatggacagtaaccagccatttcagcaactggcttgttact
agcctcagcatattttacctactcaagattgccaatttctccaaccttatatttcttcac
ttaaagaggagagttaagagtgtcgttctggtgatactgttggggcctttgctatttttg
gtttgtcatctttttgtggtaaacatgaatgagattgtacggacaaaagaatatgaagga
aacatgacttggaagagcaaattgaggagtgcagtgtacctttcaaatacgactgtaacc
atgctagcaaacttagtacccttcactctgaccctaatatcttttctgctgttaatctgt
tctctgtgtaaacatctcaagaagatgcagcttcatggcaaaggctctcaagatcccggc
accaaggtccacataaaagctttgcaaactgtgatctccttgtcgttatgtgccatttac
tttctgtccataatgatatcaagttggagtttgggaagggtggaaaacaaagctgtcttc
atgttctgcaaagctattagattcagctatccttcagcccacgcattcgtcctgatttgg
ggaaacaagaagctaaagcagactcttctttcagttttgtggaacgtgaggtactgggtg
aaaggacagaagcttcaatctccatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674187
Entry
104674187         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: taste receptor type 2 member 19-like
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674187
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674187
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674187
SSDB
Motif
Pfam: TAS2R PAG
Other DBs
NCBI-GeneID: 104674187
NCBI-ProteinID: XP_010376749
LinkDB
Position
10
AA seq 299 aa
MIXFLLIILSVLVLFTFVLGNVANSIIALVNVIDWVKTQKISSADQILTALVVSRISLFW
DKLVYWYATVFTFTLFSLEVGIVASNVSTITKHFSIWLLLASAYFVCPRFDNFCNLIFLH
LKKRIKNVALVILLGPLQFLIHNLALVTTDESVWTKEYEGNLSWKVKLRNAIHLSNMAVP
TLANFTPFTLTLISFLLLICSPCKHLKKMQLHGKGSQDLSTKVHIKAFQTMISFLMLFGI
YFLCLITSTWNSRTQQSKLVFLLCQTLAVMYPSFHSLILILGSRKPKQTFLFILGPVTC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgatatgatttctgcttattattttatcagttctggtattgtttacatttgttcttgga
aatgtagccaatagcatcatagctctagtaaatgtcattgactgggttaagacacaaaag
atctcctcagctgaccaaattctcactgctctggtggtttccagaattagtttattctgg
gataaattagtgtattggtatgcaactgtgtttactttcactttatttagtttagaagta
ggaattgttgcttctaatgtctcgacaataaccaaacatttcagcatctggttgctacta
gcctcagcatattttgtttgcccaagatttgacaatttctgcaaccttatttttctccac
ctaaagaagaggattaagaatgttgctctggtgatactgttggggcccttgcaatttttg
attcataatcttgctctggttaccacagatgagagtgtgtggacaaaagaatatgaaggg
aatttgtcttggaaggtcaaattgaggaatgcaatacacctttcaaacatggctgtaccc
acactagcaaacttcacacccttcactctgacactaatatcttttctgctgttaatctgt
tctccgtgtaaacatctcaagaagatgcagctccatggcaaaggatctcaagatctcagc
accaaggtccacataaaagctttccaaactatgatctccttcctcatgttatttggcatt
tactttctgtgtctaatcacatcaacttggaatagtaggacacagcagagcaaacttgtg
ttcctgctttgccagactcttgcagtcatgtatccttccttccactcattaatcctgatt
ctgggtagtaggaagccaaaacagacctttcttttcattttggggccggtgacatgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674188
Entry
104674188         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 31-like
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674188
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674188
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674188
SSDB
Motif
Pfam: TAS2R DUF443 RE_HpaII
Other DBs
NCBI-GeneID: 104674188
NCBI-ProteinID: XP_010376750
LinkDB
Position
10
AA seq 309 aa
MITFLPIIFSILVVVIFVIGNFANGFIALVNCIEWVKRQKISFADQILTALAVSRVGLLW
AFLLNWISNVLNLAFYSIDIRPTAYNLWVVTSHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVILVMLLGPLLFLAYHLFVVNINQIVRTKEYKGNMTWKIKLRSAMYLSDATVT
TLVNLVPFTLTLISFLLLISSLFKHLKKMQLHGKGSQDPSSKVHIKALQTVISFLLLCAI
YFVFLIISAFSFESLDNKPVFMFCQAITFSYPSAHPFILIWGNKKLKQTFLSVLLQVRYW
VKGQKPLSP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctacccatcattttttccattctagtagtggttatatttgttattgga
aattttgctaatggcttcatagcgttggtaaattgcattgagtgggtcaagagacaaaag
atctcctttgctgaccaaattctcactgctctggcagtttccagagttggtttgctctgg
gcatttttattaaattggatttcaaatgtgttgaatctagctttttatagtatagacata
agacctactgcttataacctctgggtagtaaccagccatttcagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagagtgtcattctggtgatgctgttggggcctttgctatttttg
gcttatcatctttttgtggtaaacataaatcagattgtacggacaaaagaatataaagga
aacatgacttggaaaatcaaattgaggagtgcaatgtacctttcagatgcaactgtaacc
acgctagtaaacttagtacccttcactctgaccctaatatcttttctgctgttaatctct
tctctgtttaaacatctgaagaagatgcagcttcatggcaaaggatctcaggatcccagc
agcaaggtccacataaaagctttgcaaactgtgatctctttcctcttgctatgtgccatt
tactttgtgttcctaatcatatcagcttttagttttgagagtctggataacaaacctgtc
ttcatgttctgccaagctattacattcagctatccttcagcccacccattcatactgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgctgcaagtgaggtactgg
gtgaaaggacagaagcctttatctccatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674190
Entry
104674190         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 45-like
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674190
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674190
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674190
NCBI-ProteinID: XP_010376752
LinkDB
Position
10
AA seq 309 aa
MITFLPIIFCILVVVTFVIGNFANGFIALVNCTEWVKRQKISFADQILTALAVSRIGLLW
VLLLHWYSIVLNPAFYSVEVRTTTYNVWAVTSHLSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKNVILVMLLGNLLFLPCHLFVINMNQSVQAKEYEGNMTWKIKLMRTMFLSGTTVT
MLVNLVPFTLTLISFLLLISSLCKHLKKMQLHGKGSQDPNTKVHIKALQTVIAFLLLCGI
YFVFVTISVWNLQTLDNNPVFMFCQAITFSYPSAHPFILIWGNKKLKQTFLSVLWQVRYW
VKGQKPLSP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctacccatcattttttgcattctagtagtggttacatttgttattgga
aattttgctaatggcttcatagcattggtaaattgcactgagtgggtcaagagacaaaag
atctcctttgctgaccaaattctcactgctctggctgtctccagaattggtttgctctgg
gtgttattattacattggtattcaattgtgttgaatccagctttttatagtgtagaggta
agaactaccacttataatgtctgggcagtaaccagccatttgagcaactggcttgctact
agcctcagcatattttatctgcttaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagaatgtcattctggtgatgctgttggggaatttgctatttttg
ccttgtcatctttttgtgataaatatgaatcagagtgtacaggcaaaagaatatgaagga
aacatgacttggaagatcaaattgatgaggacaatgttcctttcaggtacgactgtaacc
atgctagtaaacttagtaccctttactctgaccctgatatcttttctgctgttaatctct
tctctgtgtaaacatctcaagaagatgcagcttcatgggaaaggatctcaagatcccaat
accaaggtccacataaaagctttgcaaactgtgattgccttcctcttgttatgtggcatt
tactttgtgttcgtaaccatatcagtttggaatcttcagactctggataataaccctgtc
ttcatgttctgccaagctattacattcagctatccttcagcccacccattcatcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgtggcaagtgaggtactgg
gtgaaaggacagaagcctttatctccatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674191
Entry
104674191         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 43
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674191
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674191
SSDB
Motif
Pfam: TAS2R RE_HpaII
Other DBs
NCBI-GeneID: 104674191
NCBI-ProteinID: XP_030795011
LinkDB
Position
10
AA seq 309 aa
MITFLPIIFSILVVVTFVIGNFTNGFIALVNSVELVKRQKISFADQILTALAVSRVGLLW
VLLLNWYSTVLNPAFYSVDVRTTTYNLWAVTSHLSNWLATSLSIFYLLKIANFSNLMFLH
LKRRVKSVILVILLGPLLFLACHLFVINMNEIVRTKEYEGNMTWKIKLMSAMYLSNATVT
MLANLVPFTLTLLSFVLLICSLCKHLKKMQLHGKGCQDPSTKVHIKALQTVISFLLLCAI
YFLSIMISVWSSERLENKPFFLFCKAIRIMYPSAHAFFLIWGNKKLKQTFLSVLWQVRYW
VKGQKPSSP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctacccatcattttttccattctagtagtggttacatttgttattgga
aattttactaatggcttcatagcattggtaaattccgttgagctggtcaagagacaaaag
atctcctttgctgaccaaattctcactgctctggcagtctccagagttggtttgctctgg
gtattattattaaattggtattcaactgtgttgaatccagctttttatagtgtagatgta
agaactactacttataacctctgggcagtaaccagccatttgagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatgtttcttcac
ttaaagaggagagttaagagtgtcattctggttatactgttggggcctttgctatttttg
gcttgtcatctttttgtcataaacatgaatgagattgtacgaacaaaagaatatgaagga
aacatgacttggaagatcaaattgatgagtgcaatgtacctttcaaatgcgactgtaacc
atgctagcaaacttagtacccttcactttgaccctactatcttttgtgctgttaatctgt
tctttgtgtaaacatctcaagaagatgcagcttcatggtaaagggtgtcaagatcccagc
accaaggtccacataaaagctttgcaaactgtgatctccttcctcttgttatgtgccatt
tactttctgtccataatgatatcagtttggagttcagagaggctggaaaataaacctttc
ttcctgttctgcaaagctattagaatcatgtatccttcagcccacgcattcttcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgtggcaagtgaggtactgg
gtgaaaggacagaagccttcatctccatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674192
Entry
104674192         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 31
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674192
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674192
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674192
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674192
NCBI-ProteinID: XP_010376754
UniProt: A0A2K6NJG7
LinkDB
Position
10
AA seq 309 aa
MITFLPIIFSILVVVTFVIGNFANGFIALVNSIEWVKRQKISFADQILTALAVSRVGLLW
VLLLNWYATVLNPAFYSVEVRTTTYNVWAVTSHLSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKNVILVMLLGPLLVLACRLFMVNMNEIVRTKEYEEHMTWKIILRNAIYYPDMTVT
TLENLVPFTLTLISFLLLICSLCKHLKKMQVLGKGSQNPSTKVHIKALQIVISFLLLCVV
YFVSVIISIWSFESLGNKPVFMFCQAIRFSYSSAHPFIEIWGNKKLKQTFLSFLWNVRYW
VKGQKPSSP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctacccatcattttttccattctagtagtggttacatttgttattgga
aattttgctaatggcttcatagcattggtaaattccattgagtgggtcaagagacaaaag
atctcctttgctgaccaaattctcactgctctggcagtctccagagttggtttgctctgg
gtattattattaaattggtatgcaactgtgttgaatccagctttttatagtgtagaagta
agaactaccacttataatgtctgggcagtaaccagccatttgagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagaatgtcattctggtgatgctgttggggcctttgctagttttg
gcttgtcgtctttttatggtaaacatgaatgagattgtacggacaaaagaatatgaagaa
cacatgacttggaagatcatattgaggaatgcgatttactatccagatatgactgtaacc
acgctagagaacttagtacctttcactctgaccctgatatcttttctgctgttaatctgt
tctctgtgtaaacatctgaagaagatgcaggtccttggcaaaggatctcaaaatcccagc
accaaagtccacataaaagctttgcaaattgtgatctccttcctcttgttatgtgtcgtt
tactttgtgtctgtaattatatcaatttggagttttgagagtctgggaaacaaacctgtc
ttcatgttctgccaagctattagattcagctattcttcagcccacccattcatcgagatt
tggggaaacaagaagctaaagcagacctttctttcatttttgtggaacgtgaggtactgg
gtgaaaggacagaagccttcttctccataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674193
Entry
104674193         CDS       T03989                                 

Definition
(RefSeq) taste receptor type 2 member 46
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674193
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674193
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674193
NCBI-ProteinID: XP_010376755
LinkDB
Position
10
AA seq 308 aa
MITFLSITFSILMMVIFFIGNFANGFIALVNSIEWVKRQKISFADQILTALAVSRVGFLW
ALLLHWCATEFNLAFYSEEVRITTYNVWTVTNHFSNWLATSLSMFYFLKIATFSNLIFLH
LKRKVKSVILVTLLGPLLILVCHLFVMNMNQIVWRKEYEGNITWRIKLRSAMYLSNVTVG
MLANLIPLTLTLISFLLLIFSLCKHLKKMQAHGKGSQDPSTKVHIKALQTVTSFLLLCAI
YFLSMILSVWNFELERKPVFMFCQAIIFSYPSTHPFILIWGNKKLKQTFLSVLWNVRYWV
KGQKPSSP
NT seq 927 nt   +upstreamnt  +downstreamnt
atgataacttttctatctatcactttttccattctaatgatggttatattttttattgga
aattttgctaatggcttcatagcattggtaaattccattgagtgggtcaagagacaaaag
atctcctttgctgaccaaattctcactgctctggctgtctccagagttggttttctctgg
gcattattactacattggtgtgcaactgagtttaatctagctttttatagtgaagaagta
agaatcactacttataatgtctggacagtaaccaaccatttcagcaactggcttgctact
agcctcagcatgttttattttctcaagattgccactttctccaacctgatttttcttcac
ttaaagaggaaagttaagagtgtcattctggtgacactattggggcctttgctaattttg
gtttgtcatctttttgtgatgaacatgaatcagattgtgtggagaaaagaatatgaagga
aacattacttggaggatcaaattgaggagtgcaatgtacctttcaaatgtgactgtaggc
atgctagcaaaccttatacccctcactctgaccctgatatcttttctgctgttaatcttt
tctctgtgtaaacatctcaagaagatgcaggcccatggcaaaggatctcaagatcccagc
accaaggtccacataaaagctttgcaaactgtgacctcctttctcctgttatgtgccatt
tactttctgtccatgatcctatcagtttggaattttgagctggaaaggaaacctgtcttc
atgttctgccaagctatcatattcagctatccttcaacccacccattcatcctgatttgg
ggaaacaagaagctaaagcagacttttctttcagttttgtggaatgtgaggtactgggtg
aaaggacagaagccttcatctccatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674196
Entry
104674196         CDS       T03989                                 

Gene name
TAS2R42
Definition
(RefSeq) taste receptor type 2 member 42
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674196 (TAS2R42)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674196 (TAS2R42)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674196 (TAS2R42)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674196
NCBI-ProteinID: XP_010376757
LinkDB
Position
10
AA seq 314 aa
MATEFDKIFLTLAIVEFIIGMLGNVFTGLVNCSAGIKNQKVFSVDFILTCLAISTIGQLL
VVLFDSCVVGLAPHLYATDRVGKPVTMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSIFL
WLRWRMNRVIAILLTLSLFLLIFDCLVIEMFMDISLNIIDKSNLTLYLDESKTLYDKLSL
LKTLLSLNSFIPFSLCLTSLLFLFLSLMRHTRNLKLSSLGSRDSSTDAHRRAMKMVMPFL
FLFIVHFFSLQVTNWTFCILGNNKYTQFVMLALNAFPSCHSFILILGNSKLRQTAVRLLW
HLRNYTKRLNPLPL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccaccgaattcgataaaatctttctgactctggcaatagtggaattcatcatcggc
atgctggggaatgtgttcactggactggtaaactgctctgcagggatcaagaaccaaaag
gtcttctcagttgacttcatcctcacctgcttggctatctccacaattggtcaactgttg
gtggtactgttcgattcatgtgtagtgggacttgctccacatttatatgccacagataga
gtaggaaaacctgttactatgctttggcacatgactaatcacttgaccacctggcttgcc
acctgcctgagcattttctatttctttaagatagcccacttcccccactccattttcctc
tggctgaggtggaggatgaacagagtgattgctatactccttacattgtctctgttctta
ctgatttttgactgtttagtgatagaaatgtttatggatatctcactgaatataatagat
aaaagtaatctgactttatacttagatgaaagtaaaactctctatgataaactctctctg
ttaaaaactcttcttagcttgaacagttttatccccttttctctgtgcctgacctcattg
ctttttttatttctgtccttgatgagacatactagaaatttgaagcttagttccttgggt
tctagagactccagcacagacgcccacaggagggccatgaaaatggtgatgcctttcctt
ttcctcttcatagttcattttttttccttacaagtgacaaattggacattttgtatattg
gggaacaacaagtacacacagtttgtcatgttagccttaaatgcctttccctcgtgccac
tcatttattctcattctgggaaacagcaagctacgacagacagctgtgaggctactgtgg
catcttaggaattatacaaaaagactaaaccctttacctttgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674199
Entry
104674199         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: taste receptor type 2 member 46-like
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674199
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674199
SSDB
Motif
Pfam: TAS2R DUF443
Other DBs
NCBI-GeneID: 104674199
NCBI-ProteinID: XP_010376763
LinkDB
Position
10
AA seq 309 aa
MITFLSITFSILIMVIFFIGNFANGFIALVNSIEWVKRQKISFADQILTALAVSRVGFLW
VSLLHWCATEFNLAFYSVEVRNTAYNVWVVTNHFSSWLSTSLSIFYFLKIATFSNLIFLH
LKRRVKNVILVMLLGSLLFLACHLFVLNMNQIVQTKEYEGNMTWKIKLRSTMYFSNMTVT
MLANFVPITLTLISFLLLICSLCKHLRKMXVHGKGSQDPSTKVHIKALQTVTSFLLLCAV
YFLVIMLLVWNFERLENRSVLMFCQATVFSYPSTHPFILIWGNKKLKQIFLSALWNVRYW
VKGQKPSSL
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctgtctatcactttttccattctaataatggttatattttttattgga
aattttgctaatggcttcatagcattggtaaattccattgagtgggtcaagagacaaaag
atctcctttgctgatcaaattctcactgctctggctgtctccagagttggttttctctgg
gtatcattactacattggtgtgcaactgagtttaatctagctttttatagtgtagaagta
agaaatactgcttataatgtctgggtagtgaccaaccatttcagcagctggctttctact
agcctcagcatattttattttctcaagattgccactttctccaacctgatttttcttcac
ttaaagaggagagttaagaatgtcattctggtgatgctgttggggtctttgctatttttg
gcttgtcatctttttgtcctaaacatgaatcagattgtacagacaaaagaatatgaagga
aacatgacatggaagatcaaattgaggagtacaatgtacttttcaaatatgactgtaacc
atgctagcaaactttgtacccatcactctgaccctgatatcttttctgctgttaatctgt
tctctgtgtaaacatctcaggaagatgtaggtccatggcaaaggatctcaagatcccagc
accaaggtccacataaaagctttgcaaactgtgacctcctttctcctgttatgtgccgtt
tactttctggtcataatgctattagtttggaattttgagaggctggaaaacagatctgtc
ctcatgttctgccaagctactgtattcagctatccttcaacccacccattcatcctgatt
tggggaaacaagaagttaaagcagatttttctttcagctttgtggaatgtgaggtactgg
gtgaaaggacagaagccttcatctctgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674915
Entry
104674915         CDS       T03989                                 

Gene name
TAS2R39
Definition
(RefSeq) LOW QUALITY PROTEIN: taste receptor type 2 member 39
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674915 (TAS2R39)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674915 (TAS2R39)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674915 (TAS2R39)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674915
NCBI-ProteinID: XP_010377691
LinkDB
Position
6
AA seq 338 aa
MLGRCFPPDTKEKQQLRMIKLCDPAESELSPLLITLTLAVLLAEYLTGIIANGFITAIRA
AEWVQNKSVSTSGRILVFLSVSRIALQSLMMXEITISSTSLSFYSEDAVYYAFKISFMFL
NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRISRLIPWLLRLSVFISFSHSMFCINIC
TGYCDNSFPIHSSNSTEKTYFSETSVVSLAFFFNLGIVIPLIMFILAAILLILSLKRHTL
HMGSNATGSKDPSMEAHIGAIKATSYFLILYIFNAVALFIYPSNMFDINSLWNTLCQIIM
AAYPASHSILLIKDNPGLRRAWKRLQLRLHLYPKEWTL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgctagggagatgttttcctccagacaccaaagagaagcaacagctcaggatgattaaa
ctctgcgatcctgcagaaagtgaattgtcgccattgctcatcaccttaactttagcagtt
ttacttgctgaatacctcactggtatcattgcaaatgggttcatcacggctatacgtgca
gctgaatgggttcaaaataagtcagtttccacaagtggcaggatcctggttttcctgagt
gtatccagaatagctctccagagcctcatgatgntagaaattaccatcagctcaacctcc
ctaagtttttattctgaagatgctgtatattatgcattcaaaataagttttatgttctta
aatttttgtagcctgtggtttgctgcctggctcagtttcttctactttgtgaagattgcc
aatttctcctaccctcttttcctcaagctgaggtggagaatttctagattgataccctgg
cttctacggctgtctgtgtttatttccttcagtcacagcatgttctgcatcaacatctgc
actgggtattgtgacaattctttccctatccactcttccaactccactgagaaaacatac
ttctctgaaaccagtgtggtcagtctggcttttttctttaacctggggattgtgattcct
ctgatcatgttcatcctggcagccattctgctgatcctctctctcaagagacacacccta
cacatgggaagcaatgccacagggtccaaggaccctagcatggaggctcacattggggcc
atcaaagctaccagctactttctcattctctacattttcaatgcagttgctctgtttatc
tacccgtccaacatgtttgacatcaacagtctgtggaatactttgtgccagatcatcatg
gctgcctaccctgccagccactcaattctactgattaaggataaccctgggttgagaaga
gcctggaagcggcttcagcttcgacttcatctttacccaaaagagtggactctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674916
Entry
104674916         CDS       T03989                                 

Gene name
TAS2R40
Definition
(RefSeq) taste receptor type 2 member 40
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674916 (TAS2R40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674916 (TAS2R40)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674916 (TAS2R40)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674916
NCBI-ProteinID: XP_010377692
LinkDB
Position
6
AA seq 323 aa
MATMNTDATDKDISRFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDCIM
LMLSFSRLLLQIWMMLENIFSLLFRIVYNQNTVYILFKVITVFLNHSNLWFAAWLKVFYC
LRIANFSHPLFFLMKRKITVLMPWLLRLSVLVSLSFSFPLTKDVFNVYVNSSFPIPSYNS
TEKKYFSETNMVNLVFFYNMGIFIPLIMFILAATLLILSLKRHTLHMGSNITGSRDPSMK
AHIGAIKATSYFLILYIFNAVALFLSMSNIFDTYSYSNILCKIIMAAYPAGHSIQLILGN
PGLRRAWKRFQCQVPLYLKGQTL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcaaccatgaacacagatgccacagacaaagacatatccaggttcaaggtcaccttc
accttggtggtctccggaatagagtgcatcactggcatccttgggagtggcttcatcacg
gccatctatggggctgagtgggccaggggcaaaacactccccactggtgactgcattatg
ttgatgctgagcttttccaggctcttgctacagatttggatgatgctggagaacattttc
agtctgctattccgaattgtttataaccaaaacacagtgtatatcctcttcaaagtcatc
actgtctttctgaaccattccaatctctggtttgctgcctggctcaaagtcttctattgt
cttagaattgcaaactttagtcatcctttgttcttcctgatgaagaggaaaatcacagtg
ctgatgccttggctcctcaggctgtcagtgttggtttccttaagcttcagttttcctctc
acgaaagatgtcttcaatgtgtatgtgaatagctcctttcctatcccctcctacaactcc
acggagaagaagtacttctctgagaccaatatggttaacctggtatttttctataacatg
gggatcttcattcctctgatcatgttcatcctggcagccaccctgctgatcctctctctc
aagagacacaccctacacatgggaagcaacatcacagggtccagggaccccagcatgaag
gctcacataggggccatcaaagccaccagctactttctcatcctctacattttcaatgca
gttgctctatttctttccatgtccaacatctttgacacttacagttactcgaatattttg
tgcaagatcatcatggctgcctaccctgctggccactcaatacaactgatcttgggcaac
cctgggctgagaagagcctggaagcggtttcaatgccaagttcctctttacctaaaaggg
cagactctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674924
Entry
104674924         CDS       T03989                                 

Gene name
TAS2R60
Definition
(RefSeq) LOW QUALITY PROTEIN: taste receptor type 2 member 60
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674924 (TAS2R60)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674924 (TAS2R60)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674924 (TAS2R60)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104674924
NCBI-ProteinID: XP_010377705
LinkDB
Position
6
AA seq 318 aa
MNGDHMVLGSSVTDEKAIILVIILLLLCLVAIAGNGFITAALGMEWVLRRTLLPCDKLLV
SLGSFSFCLQXVVMGKTIYVLLYPMAFPYNPVLQFLAFQWDFLNAATLWFSSWLSVFYCV
KIATFTHPVFLWLKHKLFEWVPWMLFSSVGLSSFTTILFFIGNHRIYQNYLRNHLQPWNV
TGNSIWSYCEKFYLFPLKMITWTMSTAVFFICMILLITSLGKHMEKALLTTSGFREPSVQ
AHVKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVGESVIYLCAAVHPIILLFSN
CRLRAVLERCRSSRCGTP
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaatggagaccacatggttctaggatcttcggtgactgatgagaaggccatcatcttg
gttatcattttactccttttgtgcctggtagcaatagcaggcaatggcttcatcactgct
gctttgggtatggagtgggtgctacggagaacgttgttgccttgtgataagttactggtt
agcctagggtcctttagcttttgtctgcagtaggtggtaatgggcaagaccatttatgtt
ttgctgtatccgatggccttcccatacaaccctgtactgcagtttctagctttccagtgg
gacttcctgaatgctgccaccctgtggttctctagctggctcagtgtcttctattgtgtg
aaaattgccaccttcacccaccctgtcttcctctggctaaagcacaagttgtttgagtgg
gtaccatggatgctcttcagctctgtagggctctccagcttcaccaccattctatttttc
ataggcaaccacagaatatatcagaattatttaaggaaccatctgcaaccttggaatgtc
actggcaatagcatatggagctactgtgagaaattctaccttttccctctaaaaatgatt
acttggacaatgtccactgctgtctttttcatttgcatgattttgctcatcacgtccctg
ggaaaacacatggagaaggctctccttacaacctcaggattccgagaacccagtgtgcag
gcacacgtaaaggctctgctggctctcctttcttttgccatgctcttcatctcatatttc
ctgtcactggtgttcagtgccgcaggtatttttccacctctggactttaaattctgggta
ggggagtcagtgatttatctgtgtgcagcagttcaccccatcattctgctcttcagcaac
tgcaggctgagagctgtgctggagaggtgccgttcctcaaggtgcgggacaccttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674925
Entry
104674925         CDS       T03989                                 

Gene name
TAS2R41
Definition
(RefSeq) taste receptor type 2 member 41
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674925 (TAS2R41)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104674925 (TAS2R41)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104674925 (TAS2R41)
SSDB
Motif
Pfam: TAS2R E1-E2_ATPase
Other DBs
NCBI-GeneID: 104674925
NCBI-ProteinID: XP_010377706
LinkDB
Position
6
AA seq 307 aa
MQAALRVFFMLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGDFRFYLQL
VGTGCNFYYSAHVVKHSGGLSQQFFYLHWHFLNSVTFWFCSWLSVLFCVKIANITHPIFL
WLKWRFPGWVPWLLLGSVLISFIIALLLFWVNYSAYQQFLIRKFSGNMTYEWNTTTEIYY
FPFVQLVIWSIPCSVFLVSIMLLINSLRRHTWRMQHNGHSLQDPSTQAHTRALKFLISFL
ILYVLSFLSLIINATKFISMQNNFYWPWQIAVYLSVSVHPFILIFNNLKLQSVFWQLLLL
ARGFWVA
NT seq 924 nt   +upstreamnt  +downstreamnt
atgcaagcagcactgagggtcttcttcatgttgctctttagcctgctgagtcttctgggg
attgcagcaaatggcttcattgtgctggtgctgggcagggagtggctgcgatatggcagg
ctgctacccttggacatgatcctcattagcttgggtgacttccgcttctacctgcagttg
gttgggacagggtgcaacttctattactctgcccatgtggtcaagcactctgggggtctc
agccaacagttcttctatctacactggcacttcctgaactcagtcaccttctggttttgc
agctggctcagcgtcctgttctgtgtgaagattgctaacatcacccaccccatcttcctg
tggctgaagtggaggttcccagggtgggtgccctggctcctgttgggctctgtcctgatc
tccttcatcatagccctgctgttgttttgggtgaactactctgcatatcaacaattttta
attagaaaattttctgggaacatgacctacgagtggaatacaacgacagaaatttactat
ttcccgttcgtgcaactggtcatctggtcaattccttgttctgtttttctggtctcaatt
atgctgctaattaattctctgaggaggcatacttggagaatgcagcacaacggccacagc
ctgcaggaccccagcacccaggctcacaccagagctctgaagttcctcatctcctttctc
attctttatgttctgtcctttctgtccctgatcattaatgccacaaaatttatctccatg
cagaacaacttttactggccatggcaaattgcagtctacctgagcgtatctgtccatccc
ttcattctcatcttcaacaacctcaagcttcaaagtgtgttctggcagctcctgctgttg
gcaaggggcttctgggtggcctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682229
Entry
104682229         CDS       T03989                                 

Gene name
TAS2R13
Definition
(RefSeq) taste receptor type 2 member 13
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104682229 (TAS2R13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104682229 (TAS2R13)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104682229 (TAS2R13)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 104682229
NCBI-ProteinID: XP_010387085
LinkDB
Position
10
AA seq 303 aa
MESALSSILTLVIIAEFVIGNLSNGFIVLINCIDWVSKRQLSSVDKILIFLAISRIGLIW
EILVSWFLALHYLAIFVSGTGLRIMIFSWVVSNHFSLWLATILSIFYLLKIASFSSPAFL
YLKWRVNQVILMILLGTLVFLFLNLIQINIHIKDWLDQYERNTIWNFSMSGFPTFSVPVK
FTMTMFSLTPFTVALISFLLLSFSLWKHLQKMQLNYKGHRDPRTKAHINALKIVISFLLL
YASFFLCILISWISELYQNTLIHMLCQTIGVFYPSSHSFLLILGNPKLRQASLLVAAKVW
AKR
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaaagtgccctgtcgagtatcctcactcttgtaataattgcagaattcgtaattggg
aatttgagcaatggatttatagtactgataaactgcattgactgggtcagtaaaagacag
ctgtcctcagttgataaaatcctcattttcttggcaatctccagaattgggctgatctgg
gaaatattagtaagttggtttttagctctgcattatctagccatatttgtgtctggaaca
gggttaagaattatgatttttagctgggtagtttctaatcacttcagtctctggcttgct
acaatcctcagcatcttttatttgctcaaaatagcgagtttctctagccctgcttttctc
tatttgaagtggagagtaaaccaagtgattctgatgatactgctgggaaccttggtcttc
ttatttttaaatctgatacaaataaacatacatattaaagactggctggaccaatatgaa
agaaacacaatttggaatttcagtatgagtggctttccaacattttcagtgccggtcaaa
ttcactatgactatgttcagtctaacaccatttactgtggccctcatctcttttctcctg
ttaagtttctccttgtggaaacatctccagaaaatgcagctcaattacaaaggacacaga
gaccccaggaccaaggcccacataaatgcgttgaaaattgtgatctcattccttttactc
tatgccagtttctttctatgtattctcatatcatggatttctgagctgtatcagaataca
ctgatccacatgctttgtcagacgattggagtcttctatccttcaagccactcctttctt
ctgattttaggaaaccctaagttaagacaggcctctcttttggtggcagctaaggtatgg
gctaaacgttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115900059
Entry
115900059         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: taste receptor type 2 member 19-like
  KO
K08474  taste receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    115900059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    115900059
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    115900059
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 115900059
NCBI-ProteinID: XP_030795574
LinkDB
Position
10
AA seq 306 aa
MSIGGSNKITFLPIFSILVVVTFVLGNFANGFIALVNSIEWVNRQKISSADQILTALAVS
RVGLHWVILLLWYATVLKPDSYSLAVRITSTNAWAVTNHFSIWVATSLSIFYLFKIANFS
NFIFLHLKRRIKSVIPVILLGSLSFLVCHLVVVNMDGSMWTKEYHGNVSWEIKLSDSTHL
SDMTVTTLANLIPFILSLISFLLLXCSLNKHLKKMQLHGKGSPDPNTRVHIKALQTVISF
LLLLAVYFLSRITSIWNLRRRLQKEPVLLLCQTPAIIYPSFHSFILIWGSKKLKQTFLLI
LCQNRC
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtctattggagggtctaacaagataacttttctacccatattttccattctagtagtg
gttacatttgttcttggaaattttgctaatggcttcatagcattggtaaattccattgaa
tgggtcaacagacaaaagatctcctctgctgaccaaattctcactgctctggcagtctcc
agagttggtttgcactgggtaatattattactttggtatgcaactgttctgaaaccagat
tcatacagtttagcagtaagaattactagtactaatgcctgggcagtaaccaaccatttc
agcatctgggttgctactagcctcagcatattttatttgttcaagattgccaatttctct
aactttatttttcttcacctaaaaaggagaattaagagtgtcattccagtgatactactc
gggtctttgtcatttttggtttgtcatcttgttgtggtaaacatggatgggagtatgtgg
acaaaagaatatcatggcaacgtgagttgggagatcaaattgagtgattcaacacacctt
tcagatatgactgtaaccacgcttgcaaacttaataccctttattctgtccctgatatct
tttctgctgttantttgttctttgaataaacatctcaagaagatgcagctgcatggcaaa
ggatctccagatcccaacaccagggtccacataaaagctttgcaaactgtgatctccttc
ctcttgttacttgctgtttactttctgtcccgaatcacatcaatttggaatcttaggagg
aggctgcagaaagaacctgtcctcctgctctgccaaactcctgcaattatatatccttca
tttcattcattcatcctaatttggggaagcaagaagctaaaacagacctttcttttgatt
ttgtgtcagaataggtgctga

DBGET integrated database retrieval system