KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657016
Entry
104657016         CDS       T03989                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X1
  KO
K09593  GRB2-associated-binding protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04072  Phospholipase D signaling pathway
rro04722  Neurotrophin signaling pathway
rro05100  Bacterial invasion of epithelial cells
rro05205  Proteoglycans in cancer
rro05211  Renal cell carcinoma
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104657016 (GAB1)
   04014 Ras signaling pathway
    104657016 (GAB1)
   04072 Phospholipase D signaling pathway
    104657016 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104657016 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104657016 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104657016 (GAB1)
   05226 Gastric cancer
    104657016 (GAB1)
   05211 Renal cell carcinoma
    104657016 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    104657016 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104657016 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104657016 (GAB1)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   104657016 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_8 PH_3 PH_13
Other DBs
NCBI-GeneID: 104657016
NCBI-ProteinID: XP_010355029
UniProt: A0A2K6P4L2
LinkDB
Position
2
AA seq 724 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKFTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRATCASADSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPH
GLERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRP
DSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPT
KSVK
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagcggtggtgaagtggtctgctccggatggctccgcaagtcccccccggagaaaaag
ttgaagcgttatgcatggaagaggagatggttcgtgttacgcagtggccgtttaactgga
gatccagatgttttggaatattacaaaaatgatcatgccaagaagcctattcgtattatt
gatttaaatttatgtcaacaagtagatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagc
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatccaaca
gaagaagatcctgtaaagccacctggcagctccttacaagcaccagctgatttaccttta
gctataaatacagcaccaccatccacccaggcggattcatcctctgctactctacctcct
ccatatcagctaatcaatgttccaccacacctggaaactcttggcattcaggaggatcct
caagactacctgttgctcatcaactgtcaaagcaagaaacccgaacccaccagaacacat
gctgattctgcaaaattcacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaaatcctgcttcctcccagagcaaacatggaatgaatggcttttttcagcagcaaatg
atatacgactctccaccttcacgtgccacatgtgcttcagctgactccagcctttataac
ctgcccaggagttattcccatgatgtgttaccaaaggtgtctccgtcaagtactgaagca
gatggagaactctatgtttttaataccccttctgggacatcgagtgtagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaaccttgggacagacatcaaagctagacactattccagatatt
cctccacctcggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgt
agtatcccacgcaccgcctcagacactgacagtagttactgtatccctacagcagggatg
ccgccatcacgtagtaataccatttccactgtggatttaaacaaattgcgaaaagatgct
agttctcaagactgctatgatattccacgaacatttccaagtgatagatctagttcactt
gaaggcttccataaccactttaaagtcaaaaatgtgttgacagtgggaagtgtttcaagt
gaagaactggatgaaaattacgtcccaatgaatcccaattcaccaccacgacaacattcc
agcagttttacagaaccaattcaagaagccaattatgtgccaatgactccaggaacattt
gatttttcctcatttggaatgcaagttcctcctcctgctcatatgggcttcagatccagc
ccaaaaacccctcccagaaggccagttcctgttgcagactgtgaaccaccccccgtggat
aggaacctcaagccagacagaaaaggtcaaagtcctaaaattttaagactcaaaccccat
ggtttagagcgaactgattcacaaaccataggtgactttgctacaagaagaaaggtcaag
ccagcacctttagaaataaaacctttgccagaatgggaagaattacaagccccagttaga
tctcccatcactaggagttttgctcgagactcttctaggtttcccatgtccccccgacca
gattcagtgcatagcacaacttcaagcagtgactcacatgacagtgaagagaattatgtt
cccatgaacccaaacctgtccagtgaagacccaaatctctttggcagtaacagtcttgat
ggaggaagcagccctatgatcaagcccaaaggagacaaacaggtggaatacctagatctc
gacttggattctgggaaatccacaccaccacgtaagcaaaagagcagtggctcaggcagc
agtgtagcagatgagagagtggattatgttgttgttgaccaacagaagaccttggcccta
aagagtacccgggaagcctggacagacgggagacagtccacagaatcagaaacgccaaca
aagagtgtgaaatga

DBGET integrated database retrieval system