KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657033
Entry
104657033         CDS       T03989                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04621  NOD-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104657033 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    104657033 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 104657033
NCBI-ProteinID: XP_010355045
UniProt: A0A2K6PR19
LinkDB
Position
8
AA seq 343 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHSANRIQVANLMIQNAGAVS
AVMKTIHIFQKLNYMLLAKRLQEEKEKVDKKYKSVTKPKPLSQAEMSPAASAAIRNDVTK
QRAAPKVSPHVKPEQEQRVAQQESIREGFQKDCLPVMVLKATKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRMIIISRYYQHSGFLEVNSTSCVLDAKSDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNLLFDLSDKTGEMEVLVVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHGIIKVIKASKKT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggagatactcttgctaacgggcctggataacatcactgatgag
gaactcgataggtttaagttctttctttcagacgagtttaatatcgcgacaggcaaacta
catagtgcaaacagaatacaagtagctaacttgatgattcaaaatgctggtgcagtgtct
gcagtgatgaagaccattcatatttttcagaagttgaattacatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagaaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgagcaggaacagagggtggcc
cagcaggaatctatcagagaagggtttcagaaagactgtttgccggttatggtactgaaa
gcaacaaagcccttcacgtttgagacccaagaaggcaagcaagagatgtttcatgctaca
gtggctacagagaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaatgattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagcacctcatgtgtgttagatgctaaatctgaccaaaaggttaatgtcccgctg
aacattatcagaaaagctggtgaaaccccaaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatgggttgtttgtagtccagaaggtaacagaaaagaagaaaaattta
ttatttgacctaagtgataagactggggaaatggaagtattggtggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatggcatcataaaggttattaaggccagt
aaaaaaacatag

DBGET integrated database retrieval system