KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657287
Entry
104657287         CDS       T03989                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05200  Pathways in cancer
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657287 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104657287 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104657287 (NKX3-1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    104657287 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Trypan_PARP Homeobox_KN Homez
Other DBs
NCBI-GeneID: 104657287
NCBI-ProteinID: XP_010355351
UniProt: A0A2K6Q3L9
LinkDB
Position
9
AA seq 232 aa
MLRATEPLPGEAKAEGAARPTPSKPLTSFLIQDILRDGAQRRGGHTGSPRRRDPEPEPEP
EGGRGPAGVQNDQLSPRPRAAPEEAETLAETEPERHLGSYLLDCENTSGSLPSLPQTPKQ
PQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRK
QLSSELGDLEKHSSLPALKEEAFSRASLVSLYNNYPYYPYLYCVGSWSPAFW
NT seq 699 nt   +upstreamnt  +downstreamnt
atgctcagggccacggagccgctgcccggggaggcgaaagcggagggggccgcgcggcca
accccatccaagccgctcacgtccttcctcatccaggacatcctgcgggacggcgcgcag
cggcgaggcggccacacgggcagcccgagacggcgcgacccggagccggagccagagccg
gagggaggacgcggccccgccggggtgcagaacgaccagctgagccccaggccccgcgcc
gcgccggaggaggccgagacgctggcggagaccgagccagaaaggcacttggggtcttat
ctgttggactgtgaaaacacttcaggctcccttccaagcctcccccaaacccctaagcag
ccgcagaagcgctctcgagctgctttctcccacactcaggtgatcgagttggagaggaag
ttcagccatcagaagtacctgtcggcccctgaacgggcccacctggccaagaacctcaag
ctcacggagacccaagtgaagatatggttccagaacagacgctataagactaagcgaaag
cagctctcctcggagctgggagacttggagaagcactcctctttgccggctctgaaagag
gaggccttctcccgggcctccctggtctccttgtataacaactatccttactacccatac
ctgtactgcgtgggcagctggagcccagctttttggtaa

DBGET integrated database retrieval system