KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657298
Entry
104657298         CDS       T03989                                 

Gene name
SGCD
Definition
(RefSeq) delta-sarcoglycan isoform X1
  KO
K12563  delta-sarcoglycan
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104657298 (SGCD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104657298 (SGCD)
   05414 Dilated cardiomyopathy
    104657298 (SGCD)
   05416 Viral myocarditis
    104657298 (SGCD)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 104657298
NCBI-ProteinID: XP_030783696
LinkDB
Position
3
AA seq 290 aa
MMPQEQYTHQRSTMPGSEGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVM
NFTIDGMGNLRITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTK
VLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADDNEVVVGAERLRVLGAEGTVFPKSIET
PNVRAEPFKELRLESPTRSLVMEAPKGVEINAEAGNMEATCRTELRLESKDGEIKLDAAK
IRLPRLPHGSYTPTGTRQKVFEICVCANGRLFLSQAGAGSTCQINTSVCL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgatgcctcaggaacagtacactcaccagcggagcaccatgcccggctccgaggggcca
caggtgtacaaggtggggatttacggctggcggaaacgatgcctgtatttctttgtcctg
ctcctcatgattttaatactggtgaacttggccatgaccatctggattctcaaagtcatg
aacttcacaattgatggaatgggaaacctgaggatcacagaaaaaggtctaaagctagaa
ggagactccgaattcttacaacctctctacgccaaagaaatccagtcccgaccaggtaat
gccctgtacttcaagtctgcccgaaatgttacagtgaacattctcaatgaccagactaaa
gtgctaactcagcttataacaggtccaaaagctgtagaagcttacggcaaaaagtttgag
gtaaaaactgtttctggaaaattgctcttctctgcagacgacaatgaagtggtagtagga
gctgaaagattacgagttttaggagcggagggcacagtgttccctaaatctatagaaaca
cctaacgtcagggcagagcccttcaaggaactaaggttggagtccccaacccggtctcta
gtgatggaggccccaaaaggagtagaaatcaatgcagaagctggcaatatggaagccacc
tgcaggacagagctgagactggaatccaaagatggagagattaagttagatgctgcgaaa
attagactacctagactgcctcacggatcctacacgcctacaggaacgaggcagaaggtc
ttcgagatctgcgtgtgcgccaatgggagattattcctgtctcaggcaggagctgggtcc
acttgtcagataaacacaagtgtctgcctctga

DBGET integrated database retrieval system