KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657459
Entry
104657459         CDS       T03989                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04114  Oocyte meiosis
rro04115  p53 signaling pathway
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05205  Proteoglycans in cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05224  Breast cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104657459 (IGF1)
   04014 Ras signaling pathway
    104657459 (IGF1)
   04015 Rap1 signaling pathway
    104657459 (IGF1)
   04066 HIF-1 signaling pathway
    104657459 (IGF1)
   04068 FoxO signaling pathway
    104657459 (IGF1)
   04151 PI3K-Akt signaling pathway
    104657459 (IGF1)
   04152 AMPK signaling pathway
    104657459 (IGF1)
   04150 mTOR signaling pathway
    104657459 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104657459 (IGF1)
   04115 p53 signaling pathway
    104657459 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104657459 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104657459 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    104657459 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    104657459 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    104657459 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104657459 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    104657459 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104657459 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    104657459 (IGF1)
   04213 Longevity regulating pathway - multiple species
    104657459 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657459 (IGF1)
   05202 Transcriptional misregulation in cancer
    104657459 (IGF1)
   05205 Proteoglycans in cancer
    104657459 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    104657459 (IGF1)
   05218 Melanoma
    104657459 (IGF1)
   05215 Prostate cancer
    104657459 (IGF1)
   05224 Breast cancer
    104657459 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104657459 (IGF1)
   05414 Dilated cardiomyopathy
    104657459 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104657459 (IGF1)
   01522 Endocrine resistance
    104657459 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104657459 (IGF1)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104657459 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 104657459
NCBI-ProteinID: XP_010355571
UniProt: A0A2K6Q9L9
LinkDB
Position
10
AA seq 208 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNMKSQRRRKGGPKTHPGGEQKEGTEASLQIRGKKKEQR
REIGSRNAECRGKKGKWRTGGLSRQRQG
NT seq 627 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcactgtgcctgctc
accttcaccagctccgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgagaaggctggagatgtactgcgcacccctcaagcctgccaagtcagcccgttct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacatgaagtctcagaggagaaggaaaggtgggccaaagacacatccaggaggg
gaacagaaggaggggacagaagcaagtctgcagatcagaggaaagaagaaagagcagagg
agggagattggaagtagaaatgctgaatgcagaggcaaaaaaggaaaatggaggacagga
ggactaagcagacagaggcaaggatga

DBGET integrated database retrieval system