KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657571
Entry
104657571         CDS       T03989                                 

Gene name
TAS1R1
Definition
(RefSeq) taste receptor type 1 member 1 isoform X1
  KO
K04624  taste receptor type 1 member 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104657571 (TAS1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104657571 (TAS1R1)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104657571 (TAS1R1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 Mrr_cat
Other DBs
NCBI-GeneID: 104657571
NCBI-ProteinID: XP_010355697
UniProt: A0A0M5LKU1
LinkDB
Position
12
AA seq 841 aa
MLLCTACLVGLQLLISCCWAFACHSTKPSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVT
LCDRPGSFNEHGYHLFQAMRLGVEEINNSTALLPNVTLGYQLYDVCSDSANVYATLRVLS
LPGPRHIELQGDLLHYSPKVLAVIGPDTTNRAATTAALLSPFLMPLISYGASSETLSVKR
QYPSFLRTIPNDKYQVETMVLLLQRFGWTWISLVGSSGDYGQLGVQALEKQATDQGICIA
FKDIVPFSAQVGDERMQRLMRHLAQATATVVVVFSNRPLARVFFESVVLANLTGKVWVAS
EAWALSRHITGVPGIQRIGMVLGVAIQKRTVPGLKAFEEAYARADKGAPRPCHKSSCCSS
NQVCRECEAFTAHTMPKLKGFSMSSAYNAYQAVYAVAHGLHQLLGCASGVCSRGRVYPWQ
LLEQIHKVNFLLHEDTVMFNDNGDPLSSYNIIAWDWSGPKWTFTVLGSSTWYPVQLDINE
TKIQWHGKDNQVPNSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLYRCQPCG
KEEWAPEGSQTCFPRTVVFLACQEHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSA
GGRLCFLMLGSLAAGSSSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIF
KFSTKAPTFYHAWVQNHGAGLFVMIISASQLLICLTWLVVWTPLPTREYQRFPHLVMLEC
TEANSLGFILAFLYNGLLSISAFACSYLGKDLPENYNEAKCVTFSLLFNFMSWIAFFTTA
SIYDGKYLPAVNMLAGLSSLSSGFGGYFLPKCYVILCRPDLNSTEHFQASIQDYTRHRGS
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgctgctctgcacagcttgcctggtcggcctgcagcttctcatttcctgctgctgggcc
tttgcctgccatagcactaagccttctcctgactttaccctccccggggattacctcctg
gcaggcctgttccctctccattctggctgtctgcaggtgaggcacagacccgaggtgacc
ctgtgtgacaggcctggtagcttcaatgagcatggttaccacctcttccaggctatgcgg
cttggggttgaggagataaacaactccacggccctgctgcccaacgtcaccctggggtac
cagctgtatgatgtgtgctctgactctgccaatgtgtacgccacgctgagagtgctctcc
ctaccagggccacgccacatagagctccaaggagaccttctccactattcccctaaggtg
ttggcagtcattgggcctgacaccaccaaccgtgctgccaccacagccgccctgctgagc
cctttcctgatgcccctgatcagctatggggccagcagcgagacgctcagcgtgaagcgg
cagtatccctctttcctgcgcaccatccccaacgacaagtaccaggtggagaccatggtg
ctgctgctgcagaggttcgggtggacctggatctctctggttggcagcagtggcgactat
gggcagctaggggtgcaggcactggagaagcaggccactgatcaggggatctgcattgct
ttcaaggacatcgtgcccttctcggcccaggtaggcgatgagaggatgcagcgcctgatg
cgccacctggcccaggccacggccaccgttgtggtcgttttttccaaccggccattggcc
agggtgtttttcgagtccgtggtgctggccaacctgactggcaaggtgtgggtcgcctca
gaggcctgggccctctccaggcacatcactggggtgcccgggatccagcgcattgggatg
gtgctgggcgtagccatccagaagaggactgtgcctggcctgaaggcatttgaagaagcc
tatgcccgggcagacaagggagcccctaggccttgccacaagagctcctgctgcagcagc
aatcaggtctgcagagaatgtgaagctttcacggcacacacgatgcccaagctcaaaggc
ttctccatgagttctgcctacaacgcgtaccaggctgtgtatgcagtggcccatggcctc
caccagctcctgggctgtgcctctggagtttgttccaggggccgagtctacccctggcag
cttttggagcagatccacaaggtgaatttccttctacacgaggacactgtgatgtttaat
gacaacggagaccccctcagtagctataacataattgcctgggactggagtgggccgaag
tggaccttcacagtccttggttcctccacgtggtatccagttcagctagacataaatgag
accaaaatccagtggcatggaaaggacaaccaggtacctaactctgtgtgttccagtgac
tgtcttgaagggcatcagcgagtggttacaggtttccatcactgttgctttgagtgtgtg
ccctgtggggctgggaccttccttaacaagagtgacctctacagatgccagccttgtggg
aaagaagaatgggcacctgagggaagccagacctgcttcccgcgcactgtggtgtttttg
gcttgtcaagagcacacctcttgggtgctgctggcagctaacacgctgctgctgctgttg
ctgcttgggactgctggcctgtttgcctggcacctagacacccctgtggtgaggtcagca
gggggccgcctgtgctttcttatgctgggctccctggcagcaggtagcagcagcctctat
ggcttctttggggagcccacgaggcctgcatgcttgctgcgccaggccctctttgccctt
ggtttcaccatcttcctgtcctgcctgacagttcgctccttccaactaatcatcatcttc
aagttttccaccaaggcacctacattctaccacgcctgggtccaaaaccatggtgctggc
ctgtttgtgatgatcatctcagcgtctcagctgcttatctgtctaacttggctggtggtg
tggactccactgcccactagggaataccagcgcttcccccatctggtgatgcttgagtgc
acagaggccaactccctgggcttcatactggcctttctctacaatggccttctctccatc
agtgcctttgcctgcagctacctgggcaaggacttgccagagaactacaacgaggccaaa
tgtgtcaccttcagcctgctcttcaacttcatgtcctggatcgccttcttcaccacggcc
agcatctacgacggcaagtatctgcccgcggtcaacatgctggctgggctgagcagcctg
agcagcggcttcggcgggtattttctgcccaagtgctacgtgatcctctgccgcccagac
ctcaacagcacagagcacttccaggcctccattcaggactacacgaggcaccgcggctcc
acctga

DBGET integrated database retrieval system