KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657609
Entry
104657609         CDS       T03989                                 

Gene name
HMX2
Definition
(RefSeq) homeobox protein HMX2
  KO
K09349  homeobox protein Nkx-5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104657609 (HMX2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104657609 (HMX2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104657609
NCBI-ProteinID: XP_010355751
UniProt: A0A2K6QLW9
LinkDB
Position
11
AA seq 273 aa
MGSKEDAGKGCPAASGISSFTIQSILGGGPSEAPREPVVWPARKRSLSVSSEEEEPDDGW
KAPACFCPDPHGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGSERTPFLSPSHSDFKEEK
ERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERA
CLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVGMPLVFRDSSLLRV
PVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggcagcaaagaagatgcgggcaagggttgtccggcggccagtggcatctccagcttc
accatccagtccatcctgggcgggggcccttcggaggcaccgcgggagcccgtcgtttgg
ccagcaaggaagcgcagcctatccgtgtcctcggaggaggaggagccggacgacggctgg
aaggcgcccgcctgcttctgcccagatccgcacggccccaaggagcagggccccaagcac
catccccccatcccttttccttgcctgggtacccccaagggcagcggaggctcgggcccc
ggcggctcggagcgcacgcctttcctctctccttcgcactcggactttaaagaagagaaa
gagaggctcctgcccgcgggctcgccctcgccagggtccgagcggccgcgggacggcggc
gctgagcggcaggctggcgcggccaagaagaagacgcgcacagtcttttcgcgcagccag
gtgtaccagctcgagtccaccttcgacatgaagcgctacctgagcagctcggagcgcgcc
tgcctcgcctccagcctgcagctcacggagacccaggtcaagacttggttccagaaccgc
cgcaacaagtggaagcggcagctctcggcagagctggaggcggccaacatggcgcacgcg
tcggctcagactctggtgggcatgccgctggtgttccgggacagctcgctgctgcgcgtg
ccggtgccgcgctcgctcgcctttcccgcgccgctctactacccgggcagcaacctctcg
gccttacctctctacaacctctacaacaagctcgactactga

DBGET integrated database retrieval system