KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657765
Entry
104657765         CDS       T03989                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04060  Cytokine-cytokine receptor interaction
rro04068  FoxO signaling pathway
rro04144  Endocytosis
rro04218  Cellular senescence
rro04350  TGF-beta signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04659  Th17 cell differentiation
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05142  Chagas disease
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104657765 (TGFBR1)
   04350 TGF-beta signaling pathway
    104657765 (TGFBR1)
   04390 Hippo signaling pathway
    104657765 (TGFBR1)
   04371 Apelin signaling pathway
    104657765 (TGFBR1)
   04068 FoxO signaling pathway
    104657765 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104657765 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104657765 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    104657765 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104657765 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104657765 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104657765 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104657765 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657765 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104657765 (TGFBR1)
   05212 Pancreatic cancer
    104657765 (TGFBR1)
   05225 Hepatocellular carcinoma
    104657765 (TGFBR1)
   05226 Gastric cancer
    104657765 (TGFBR1)
   05220 Chronic myeloid leukemia
    104657765 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104657765 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104657765 (TGFBR1)
   05161 Hepatitis B
    104657765 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104657765 (TGFBR1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     104657765 (TGFBR1)
Protein kinases [BR:rro01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   104657765 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 104657765
NCBI-ProteinID: XP_030775313
LinkDB
Position
16
AA seq 504 aa
MEAAAAAPRPRLLLLVLATAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTD
KVIHNSMCIAEIDLIPPDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGPFSVKSSP
GLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKD
LIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREE
RSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTV
EGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHD
SATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGG
IHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANG
AARLTALRIKKTLSQLSQQEGIKM
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccgcgtccccggctgcttctcctcgtgctggcgacggcg
gcggcggcgctgctcccgggggcgacggcattacagtgtttctgccacctctgtacaaaa
gacaattttacttgtgtgacagatgggctctgctttgtctctgtcacagagaccacagac
aaagttatacacaacagcatgtgtatagctgaaattgacttaattcctccagataggcca
tttgtttgtgcaccctcttcaaaaactgggtctgtgactacaacatattgctgcaatcag
gaccattgcaataaaatagaacttccaactactggccctttttcagtaaagtcgtcacct
ggccttggtcccgtggaactggcagctgtcattgctggaccagtgtgctttgtctgcatc
tcactcatgttgatggtatatatctgccacaatcgcactgtcattcaccatcgagtgcca
aatgaagaggacccttcattagatcgcccttttatttcagagggcaccacgttgaaagac
ttaatttatgatatgacaacatcaggttctggctcaggtttaccattgcttgttcagagg
acaattgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttggagaagtg
tggcgaggaaagtggcggggagaagaagttgctgttaagatattctcttctagagaagaa
cgttcatggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaaaacatc
ctgggatttatagcagcagacaataaagacaatggcacttggactcagctctggttggtg
tcagattatcatgagcatggatccctttttgattacttaaacagatacacagttactgtg
gaaggaatgataaaacttgctctgtccacagcgagtggtcttgcccatcttcacatggag
attgttggtacccaaggaaagccagccattgctcatagagatttgaaatcaaagaatatc
ttggtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaagacacgat
tcagccacagataccattgatattgctccaaaccacagagtgggaacaaaaaggtacatg
gcccctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaacgtgct
gacatctatgcaatgggcttagtattctgggaaattgctcgacgatgttccattggtgga
attcatgaagattaccagctgccttattatgatcttgtaccttctgacccatcagtggaa
gaaatgagaaaagttgtttgtgaacagaagttaaggccaaatatcccaaacagatggcag
agctgcgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaacgga
gcagctaggcttacagcattgcggattaagaaaacattatcacaactcagtcaacaggaa
ggcatcaaaatgtaa

DBGET integrated database retrieval system