KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657770
Entry
104657770         CDS       T03989                                 

Gene name
GABBR2
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04727  GABAergic synapse
rro04742  Taste transduction
rro04915  Estrogen signaling pathway
rro04929  GnRH secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104657770 (GABBR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104657770 (GABBR2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    104657770 (GABBR2)
   04915 Estrogen signaling pathway
    104657770 (GABBR2)
  09156 Nervous system
   04727 GABAergic synapse
    104657770 (GABBR2)
  09157 Sensory system
   04742 Taste transduction
    104657770 (GABBR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104657770 (GABBR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104657770 (GABBR2)
G protein-coupled receptors [BR:rro04030]
 Metabotropic glutamate receptor family
  GABA
   104657770 (GABBR2)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor GBR2_CC Peripla_BP_6 Cation_ATPase_C GAPT GWT1 DUF812 APG6_N HOOK
Other DBs
NCBI-GeneID: 104657770
NCBI-ProteinID: XP_010355934
LinkDB
Position
16
AA seq 941 aa
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggcttccccgcggagctccgggcagcccgggccgccgccgccgccgccaccgccgccc
gcgcgcctgctgctgctactgctgctgccgctgctgctgcctctggcgcccggggcctgg
ggctgggcgcggggcgccccacggccgccgcccagcagcccgccgctctccatcatgggc
ctcatgccgctcaccaaggaggtggccaagggcagcatcgggcgcggtgtgctccccgcc
gtggaactggccatcgagcagatccgcaacgagtcactcctgcgcccctacttcctcgac
ctgcggctctatgacaccgagtgcgacaatgcgaaagggttgaaagccttctatgatgca
ataaaatacgggccgaaccacttgatggtgtttggaggtgtctgtccatccgtcacatcc
atcattgcagagtccctccaaggctggaatctggtgcagctttcttttgctgcaaccacg
cctgttctagcagataagaaaaaatacccttatttctttcggaccgtcccatcagacaac
gcggtgaatccagccattctgaagttgctcaagcactaccagtggaagcgcgtgggcacg
ctgacgcaagacgttcagaggttctctgaggtgcggaacgacctgactggcgttctgtat
ggcgaagacattgagatttcagacaccgagagcttctccaatgatccctgtaccagtgtc
aaaaagctgaaggggaatgatgtgcggatcatccttggccagtttgaccagaatatggca
gcaaaagtattctgttgtgcatatgaggagaacatgtatggtagtaaataccagtggatc
attccgggctggtacgagccttcttggtgggagcaggtgcacacggaagccaactcatcc
cgctgcctccggaagaatctgcttgctgccatggagggctacattggtgtggatttcgag
cccctgagctccaagcagatcaagaccatctcaggaaagactccacagcagtatgagaga
gagtacaacaacaagcggtcaggcgtggggcccagcaagttccacgggtatgcctacgat
ggcatctgggtcatcgccaagacactgcagagggccatggagacgctgcatgccagcagc
cggcaccagcggatccaggacttcaactacacggaccacacgctgggcaggatcatcctc
aatgccatgaacgagaccaacttcttcggggtcacgggtcaagttgtgttccggaacggg
gagagaatgggaaccattaagtttactcaatttcaagacagcagggaggtgaaggtggga
gagtacaacgctgtggccgacacactggagatcatcaatgacaccatcaggttccaagga
tccgaaccaccaaaagacaagaccatcatcctggagcagctgcggaagatctccctacct
ctctacagcatcctctctgccctcaccatcctcgggatgatcatggccagtgcttttctc
ttcttcaacatcaagaaccggaatcagaagctgataaagatgtcgagtccatacatgaac
aaccttatcatcctcggagggatgctctcttatgcgtccatatttctctttggcctggat
ggatcctttgtctctgaaaagacttttgaaacactttgcaccgtcaggacctggattctc
accgtgggctacacaactgcttttggggccatgtttgcaaagacttggagagtccacgcc
atcttcaaaaatgtgaaaatgaagaagaagatcatcaaggaccagaaactgcttgtgatt
gtgggcggcatgctgctgattgacctgtgtatcctgatctgctggcaggccgtggacccc
ctgcggaggacagtggagaagtacagcatggagcctgacccagcaggacgggatatctcc
atccgccctctcctggagcactgtgagaacacccacatgaccatctggcttggcatcgtc
tatgcctacaagggacttctcatgttgttcggttgtttcttagcttgggagacccgcaac
gtcagcatccctgcactcaacgacagcaagtacatcgggatgagcgtctacaacgtgggg
atcatgtgcatcattggggccgctgtctccttcctgacccgggaccagcccaacgtgcag
ttctgcatcgtggctctggtcatcatcttctgcagcaccatcaccctctgcctggtgttt
gtgccaaagctcatcaccctgcgaacaaacccagatgcagcaacgcagaacaggcgattc
cagttcactcagaatcagaagaaagaagattctaaaacatccacctcagtcaccagtgtg
aaccaagccagcacatcccgcctggagggcctacagtcagaaaaccaccgcctgcgaatg
aagatcacagagctggataaagacttggaggaggtcaccatgcagctgcaggacacacca
gaaaagaccacctacattaaacagaaccactaccaagagctcaatgacatcctcaacctg
ggaaacttcactgagagcacagatggaggaaaggccattttaaaaaatcacctcgatcaa
aatccccagctacagtggaacacaacagagccctctcgaacgtgcaaagatcctatagaa
gatataaactctccagaacacatccagcgtcggctgtccctccagctccccatcctccac
cacgcctacctcccatccatcggaggcgtggacgccagctgtgtcagcccctgtgtcagc
cccaccgccagcccccgccacagacatgtgccaccctccttccgagtcatggtctcgggc
ctgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676766
Entry
104676766         CDS       T03989                                 

Gene name
GABBR1
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1 isoform X1
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04727  GABAergic synapse
rro04742  Taste transduction
rro04915  Estrogen signaling pathway
rro04929  GnRH secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104676766 (GABBR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104676766 (GABBR1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    104676766 (GABBR1)
   04915 Estrogen signaling pathway
    104676766 (GABBR1)
  09156 Nervous system
   04727 GABAergic synapse
    104676766 (GABBR1)
  09157 Sensory system
   04742 Taste transduction
    104676766 (GABBR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104676766 (GABBR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104676766 (GABBR1)
G protein-coupled receptors [BR:rro04030]
 Metabotropic glutamate receptor family
  GABA
   104676766 (GABBR1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 UPF0242 DUF3995 NEMP PKcGMP_CC COX1
Other DBs
NCBI-GeneID: 104676766
NCBI-ProteinID: XP_030784415
LinkDB
Position
4
AA seq 784 aa
MSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP
IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTR
VKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQ
DARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTE
AVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWAL
ALALNKTSGGGGHSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWT
LIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSV
LSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRN
QFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLL
VGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYK
GLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFA
SLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRE
LEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPPEPPDRLSCDGSRVH
LLYK
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgagtgggggctggccagggggccaggcctgccagcccgcggtggagatggcgctggag
gacgtgaatagccgcagggacatcctgccggactatgagctcaagctcatccaccacgac
agcaagtgtgatccaggccaggccaccaagtacctgtatgagctgctctacaacgaccct
atcaagatcatccttatgcctggctgcagctctgtctccacgctggtggctgaggctgct
aggatgtggaacctcattgtgctttcctatggctccagctcaccagccctgtcaaatcgg
cagcgtttccccactttcttccgaacgcacccatcagccacactccacaaccctacccgc
gtgaaactctttgaaaagtggggctggaagaagattgctaccatccagcagaccactgag
gtcttcacttcgactctggacgacctggaggaacgagtgaaggaggctggaattgagatt
actttccgccagagtttcttctcagatccggctgtgcctgtcaaaaacctgaagcgccag
gatgcccgaatcatcgtgggacttttctatgagactgaagcccggaaagttttttgtgag
gtgtacaaggagcgtctctttgggaagaagtacgtctggttcctcattgggtggtatgct
gacaattggttcaagatctacgacccttctatcaactgcacagtggatgagatgactgag
gccgtggagggccacatcaccactgagattgtcatgctgaatcctgccaacacccgcagc
atttccaacatgacatcccaggaatttgtggagaaactaaccaagcgactgaaaagacac
cctgaggagacaggaggtttccaggaggcaccgctggcctatgatgccatctgggccttg
gcattggccctgaacaagacatctggaggaggcggccattctggcgtgcgcctggaggac
ttcaactacaacaaccagaccattaccgaccaaatctaccgggcaatgaactcctcgtcc
tttgagggtgtctctggccatgtggtgtttgatgccagtggctctcggatggcatggacg
cttatcgagcagctgcagggtggcagctacaagaagattggctactatgacagcacgaag
gatgatctttcctggtccaaaacagataagtggattggagggtcccccccagctgaccag
accctggtcatcaagacattccgcttcctgtcacagaaactctttatctccgtctcggtt
ctctccagcctgggcattgtcctagctgttgtctgtctgtcctttaacatctacaactca
catgtccgttatatccagaactcacagcccaacctgaacaacctgactgctgtgggctgc
tcactggcattagctgctgtcttccccctggggctggatggttaccacattgggaggaac
cagttccctttcgtctgccaggcccgcctctggctcctgggcctgggctttagtctgggc
tatggctccatgttcaccaagatttggtgggtccacacggtcttcacaaagaaggaagaa
aagaaggagtggagaaagactctggaaccctggaagctatatgccacagtgggcctgctg
gtgggcatggatgtcctcactctcgccatctggcagattgtggaccctttgcatcgaacc
attgagacatttgccaaggaggaaccaaaggaagatatcgacgtctctattctgcctcag
ctggagcattgcagctccaggaagatgaatacatggcttggcattttctacggttacaag
ggactgctgctgctgctgggaatcttccttgcttatgagaccaagagtgtgtccactgag
aagatcaatgaccaccgggctgtaggcatggctatctacaatgtggccgtcctgtgcctc
atcaccgctcctgtcaccatgattctgtccagccagcaggatgcagcctttgcctttgcc
tctcttgccatagttttctcctcctatattactcttgttgtgctctttgtgcccaagatg
cgcaggctgatcacccgaggggaatggcagtcggaggcgcaggacaccatgaagacaggg
tcatcgaccaacaacaacgaggaggagaagtcccggctgttggagaaggagaaccgcgaa
ctggaaaagatcattgctgagaaagaggagcgtgtctctgaactgcgccatcaactccag
tctcggcagcagctccgctcccggcgccacccgccaacacccccagacccctctgggggc
ctgcccaggggaccccctgagccccccgaccggcttagctgtgatgggagtcgagtgcat
ttgctttataagtga

DBGET integrated database retrieval system