KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657941
Entry
104657941         CDS       T03989                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04510  Focal adhesion
rro04650  Natural killer cell mediated cytotoxicity
rro04722  Neurotrophin signaling pathway
rro04910  Insulin signaling pathway
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04935  Growth hormone synthesis, secretion and action
rro05034  Alcoholism
rro05100  Bacterial invasion of epithelial cells
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05220  Chronic myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104657941 (SHC4)
   04014 Ras signaling pathway
    104657941 (SHC4)
   04072 Phospholipase D signaling pathway
    104657941 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104657941 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104657941 (SHC4)
   04062 Chemokine signaling pathway
    104657941 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104657941 (SHC4)
   04915 Estrogen signaling pathway
    104657941 (SHC4)
   04917 Prolactin signaling pathway
    104657941 (SHC4)
   04926 Relaxin signaling pathway
    104657941 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    104657941 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104657941 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104657941 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104657941 (SHC4)
   05226 Gastric cancer
    104657941 (SHC4)
   05214 Glioma
    104657941 (SHC4)
   05220 Chronic myeloid leukemia
    104657941 (SHC4)
   05224 Breast cancer
    104657941 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    104657941 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    104657941 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104657941 (SHC4)
   01522 Endocrine resistance
    104657941 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 104657941
NCBI-ProteinID: XP_010356107
UniProt: A0A2K6NW20
LinkDB
Position
5
AA seq 630 aa
MRERSQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLEEGSSGGSVGNKGSPQPPH
PALAPHLPAEDAALPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSSPSSPETSLSRSGTAPPPQPDLVGHRATTLTPDSCPLPGPGEPPLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVINTIGQAFELRFKQYLKNPSLDTSCESEEV
HIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTLGSAGN
QSSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcagccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcgatcacgtcc
ttggaagaaggtagctccggaggctcggtcgggaacaagggctcaccacagcctccccac
cccgccctggcacctcacctgccggctgaagatgccgccttgccgtcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcgagcatgaagctggccaacccggccact
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgcctcggctgaagctccag
gaaagccgggacccaggttccagcagtccctcttccccagaaaccagtctaagtaggtct
gggactgcacctccaccgcagccggacctggtgggccacagggcaaccaccctaacccct
gattcgtgcccgcttcctggccctggggagccaccccttaggagcaggcaggacaggcac
tttctacagcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcaggaatg
aatataaaactgaccatctcaacatgcagtctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatattg
gaatgccacaatggaatggcccaagatgtcataaataccataggacaggcttttgaactg
cggtttaaacagtacttgaaaaatccttctttagatacgtcttgtgaaagtgaggaggtg
catattgatagccatgccgaggagagagaagatcatgaatattacaatgaaattccaggg
aagcagccaccagtaggtggtgtttctgatatgcggatcaaagttcaagccacggaacaa
atggcttactgccccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggcaataggtaatgtccatccaaga
ggggtgcagtcccagcgagatacctcattattgaagcacacgtgccgagtggatctcttc
gatgacccctgctacattaatacacaggctcttcaaagtacacttggctctgctggaaat
caaagctcagcccaaccactggggagcccgtggcactgcggaaaagcaccagaaactgtt
cagccaggtgccacggcccagcctgccagctcacattctttgccacacattaagcagcag
ctgtggagtgaagaatgctatcatggcaagctgagcaggaaggcggcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatcccctggccaatatgtgctg
agtggactacagggaggccaagcaaaacatcttcttctggtggatcctgaaggcaaggtg
aggaccaaggatcatgtatttgataacgtcggccaccttatcaggtaccatatggataac
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
aataatccagcacttttgcattccaacaaatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663483
Entry
104663483         CDS       T03989                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04510  Focal adhesion
rro04650  Natural killer cell mediated cytotoxicity
rro04722  Neurotrophin signaling pathway
rro04910  Insulin signaling pathway
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04935  Growth hormone synthesis, secretion and action
rro05034  Alcoholism
rro05100  Bacterial invasion of epithelial cells
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05220  Chronic myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104663483 (SHC1)
   04014 Ras signaling pathway
    104663483 (SHC1)
   04072 Phospholipase D signaling pathway
    104663483 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104663483 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104663483 (SHC1)
   04062 Chemokine signaling pathway
    104663483 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104663483 (SHC1)
   04915 Estrogen signaling pathway
    104663483 (SHC1)
   04917 Prolactin signaling pathway
    104663483 (SHC1)
   04926 Relaxin signaling pathway
    104663483 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    104663483 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104663483 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104663483 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104663483 (SHC1)
   05226 Gastric cancer
    104663483 (SHC1)
   05214 Glioma
    104663483 (SHC1)
   05220 Chronic myeloid leukemia
    104663483 (SHC1)
   05224 Breast cancer
    104663483 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    104663483 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    104663483 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104663483 (SHC1)
   01522 Endocrine resistance
    104663483 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 104663483
NCBI-ProteinID: XP_010362972
LinkDB
Position
8
AA seq 584 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPADHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARSTAPSAQTPSHLGATLPVGHPVGGDPEVRKQMPPPSSCPAGR
ELFDDPSYVNVQNLDKVRQAVGGAGLPNPAVNGSAPRDLFDMKPFEDALRVPPPPQSVSM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatcttctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccacccccccggaggagctgccttccccatcagcttca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactactctgtgctcc
ttcttcccccggatgagcaacctgaggctggccaacccggctggggggcgcccagggtct
aagggggagccaggaagggcagccgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtccttcagtcaatgcgtgccctggac
ttcaacacccggactcaggttaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctctaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggaggggatccggacacagccgagtatgtcgcctacgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcctgaagggcttgcccaggatgtc
atcagcaccattggccaggccttcgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcacccctcatgacaggatggctggctttgatggctcagcgtgggatgaggag
gaggaagagccagctgaccatcagtactataatgacttcccggggaaggaaccccccctg
gggggggtggtagacatgaggcttcgggaaggagctgctccaggggctgctcgatccact
gcacccagtgcccagacccctagccacttgggagctacactgcctgtaggacaccctgtt
gggggagatccagaagtccgaaaacagatgccacctccatcatcctgtccagcaggcaga
gagctctttgacgatccctcctatgtcaacgtccagaacctagacaaggtccggcaagca
gtgggtggtgctgggctccccaatcctgctgtcaatggcagtgcaccccgtgacctgttt
gatatgaagccctttgaagatgctcttcgggtgcctccacctccccagtcagtgtccatg
gctgagcagctccgaggagagccctggttccatgggaagctgagtcggcgggaggctgag
gcactgctgcagctcaacggggacttcctggtgcgggagagcacgaccacacctggccag
tatgtgctcactggcttgcagagtgggcagcccaagcatctgctactggtggaccctgag
ggtgtggttcggactaaggatcaccgctttgagagtgtcagtcacctcatcagctaccat
atggacaatcacttgcccatcatctctgcgggcagcgaactatgtctacagcaacctgtg
gagcggaaactgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668515
Entry
104668515         CDS       T03989                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3 isoform X1
  KO
K17448  SHC-transforming protein 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04510  Focal adhesion
rro04650  Natural killer cell mediated cytotoxicity
rro04722  Neurotrophin signaling pathway
rro04910  Insulin signaling pathway
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04935  Growth hormone synthesis, secretion and action
rro05034  Alcoholism
rro05100  Bacterial invasion of epithelial cells
rro05214  Glioma
rro05220  Chronic myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104668515 (SHC3)
   04014 Ras signaling pathway
    104668515 (SHC3)
   04072 Phospholipase D signaling pathway
    104668515 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104668515 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104668515 (SHC3)
   04062 Chemokine signaling pathway
    104668515 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104668515 (SHC3)
   04915 Estrogen signaling pathway
    104668515 (SHC3)
   04917 Prolactin signaling pathway
    104668515 (SHC3)
   04926 Relaxin signaling pathway
    104668515 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    104668515 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104668515 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104668515 (SHC3)
   05226 Gastric cancer
    104668515 (SHC3)
   05214 Glioma
    104668515 (SHC3)
   05220 Chronic myeloid leukemia
    104668515 (SHC3)
   05224 Breast cancer
    104668515 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    104668515 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    104668515 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104668515 (SHC3)
   01522 Endocrine resistance
    104668515 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 104668515
NCBI-ProteinID: XP_010369572
LinkDB
Position
16
AA seq 598 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPPPPHAPA
MSTARKGRPGDEPLPRTPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKVPPPGGFLDARL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPFRPSERQGSLDIYGMPEGKLHVA
PTGEAPTYVNTQQIPPQAWPTAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVE
CISPVSPRAPDAKMLEDLQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGM
HNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgagcggcggcggaggcaaggtttcagcggcgcgcgcgacc
ccggcggcggctccctacttggtgtccggcgaggcgctgcgcaaggcgcccgacgatggg
cccggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggc
ctccgcggcctgtcgtcggccgcccgggagcgggcgggcgcgcggctctccggcagctgc
agcgcgcccagcctggccgccccggacggcagcgcgcccccgccgccccacgccccggcc
atgagcaccgccaggaagggccggccgggcgacgagccgctgcccagaacccctcggggg
gcgccgcacgccagcgaccaggtgctggggcccggagtcacctacgtggtcaagtacttg
gggtgcattgaagttctgcgctcaatgaggtctcttgacttcagtacaagaacacaaatt
accagggaagccatcagccgtgtctgtgaagctgtgcctggtgccaagggagccttcaag
aagagaaagcctccgagcaaaatgctgtccagcatcttgggaaagagcaacctccagttt
gcgggaatgagcatctctctgaccatctccacggccagtctgaacctgcgaactccggac
tccaaacagatcatagcgaatcaccacatgcggtccatttccttcgcctctgggggagac
ccggacacaactgactatgttgcatatgtggctaaggaccctgttaatcgcagagcttgt
cacattttggaatgctgtgatgggctggcccaggatgtcatcggctccataggacaagcc
tttgagctccggtttaagcaatatttacagtgtcctaccaagattcccgctctccatgat
cgaatgcagagtctggatgagccatggacagaagaggagggagatggctcagaccacccg
tactacaacagcatcccaagcaaggtgcctcctccagggggctttcttgatgctcggctg
aaacctagaccccatgctcccgacactgcacagtttgcaggaaaagagcagacttattac
cagggaagacacttaggagacacctttggcgaagactggcagcaaacacctttcaggcca
agtgagagacaagggtccttggacatctacggcatgccagaagggaaactgcacgtggcc
cccacaggagaagcacccacctacgtcaacacgcagcagatcccaccgcaggcctggccg
actgcggtcagcagcgctgagagcagcccgagaaaagacctctttgacatgaaacctttt
gaagatgctctcaagaaccagcccttggggcccgtgttaagcaaggcagcctccgtggag
tgcatcagccctgtgtcacccagagccccggatgccaagatgctggaggacctgcaagct
gagacttggtaccaaggagagatgagcaggaaggaggcagaggggctgctggagaaagat
ggagacttcctggtcaggaagagcaccaccaacccgggctcctttgtcctcacgggcatg
cacaatggccaggccaagcacctgctgctcgtggacccggaaggcacgatccggacgaaa
gacagagtctttgacagcatcagccacctcatcaaccaccacctagagagcagcctgccc
atcgtctctgcagggagtgagctgtgcctccagcagccagtggagaggaagcagtga

DBGET integrated database retrieval system