KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657982
Entry
104657982         CDS       T03989                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X3
  KO
K08525  retinoid X receptor beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03320  PPAR signaling pathway
rro04659  Th17 cell differentiation
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05216  Thyroid cancer
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104657982 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104657982 (RXRB)
   03320 PPAR signaling pathway
    104657982 (RXRB)
   04919 Thyroid hormone signaling pathway
    104657982 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    104657982 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657982 (RXRB)
   05202 Transcriptional misregulation in cancer
    104657982 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    104657982 (RXRB)
   05216 Thyroid cancer
    104657982 (RXRB)
   05222 Small cell lung cancer
    104657982 (RXRB)
   05223 Non-small cell lung cancer
    104657982 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104657982 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rro03310]
    104657982 (RXRB)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    104657982 (RXRB)
Nuclear receptors [BR:rro03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   104657982 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 104657982
NCBI-ProteinID: XP_010356168
LinkDB
Position
4
AA seq 441 aa
MPQGSVGRWGCEKKCIVGSRPGGGGDGPGWIPQRRRRRRWQAENNKPRSRSRGRLDGTGW
ATAGGINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKH
YGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQ
EERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPV
TNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGIL
LATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAK
GLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKL
IGDTPIDTFLMEMLEAPHQLA
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgccgcagggcagtgtgggccggtgggggtgcgaaaagaaatgcattgtggggtcgcgt
cccggtggcggcggcgacggccctggctggatcccgcagcggcggcggcggcggcggtgg
caggcggagaacaacaaaccccggagccggagccgggggaggctggacgggacgggatgg
gcgacagcgggcgggattaactcaacagtgtcactccctgggggtgggtctggcccccct
gaagatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccccctccaggt
ggccctggggctggcaaacggctatgtgcaatctgcggggacagaagctcaggcaaacac
tacggggtttacagctgtgagggttgcaagggcttcttcaaacgcaccatccgcaaggac
cttacatactcttgccgggacaacaaagactgcacagtggacaagcgccagcggaaccgc
tgtcagtactgccgctatcagaagtgcctggccactggcatgaagagggaggcggtacag
gaggagcgtcagcggggaaaagacaaggatggggatggggagggggctgggggagccccc
gaggagatgcctgtggacaggatcctggaggcagagcttgctgtggagcagaagagtgac
cagggcgttgagggtcctgggggaaccgggggtagcggcagcagtccaaatgaccccgtg
actaacatctgtcaggcagctgacaaacagctattcacgcttgttgagtgggcgaagagg
atcccacacttttcctccttgcctctggatgatcaggtcatattgctgcgggcaggctgg
aatgagctcctcattgcctccttctcccaccgatccattgacgttcgagatggcatcctc
cttgccacaggtcttcacgtgcaccgcaactcagcccattcggcaggagtaggagccatc
tttgatcggtccctctccagggtgctgacagagctagtgtccaaaatgcgagacatgagg
atggacaagacagagcttggctgcctgagggcaatcattctgtttaatccagatgccaag
gggctctccaaccctagtgaggtggaggtcctgcgggagaaagtgtatgcatcactggag
acctactgcaaacagaagtaccctgagcagcagggacggtttgccaagctgctgctacgt
cttcctgccctccggtccatcggccttaagtgtctagagcatctgtttttcttcaagctc
attggtgacacccccattgataccttcctcatggagatgcttgaggctccccatcaactg
gcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669710
Entry
104669710         CDS       T03989                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X3
  KO
K08524  retinoid X receptor alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03320  PPAR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04659  Th17 cell differentiation
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04932  Non-alcoholic fatty liver disease
rro04976  Bile secretion
rro05160  Hepatitis C
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05216  Thyroid cancer
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104669710 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104669710 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104669710 (RXRA)
   03320 PPAR signaling pathway
    104669710 (RXRA)
   04919 Thyroid hormone signaling pathway
    104669710 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    104669710 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    104669710 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669710 (RXRA)
   05202 Transcriptional misregulation in cancer
    104669710 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    104669710 (RXRA)
   05216 Thyroid cancer
    104669710 (RXRA)
   05222 Small cell lung cancer
    104669710 (RXRA)
   05223 Non-small cell lung cancer
    104669710 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104669710 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104669710 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104669710 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rro03310]
    104669710 (RXRA)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    104669710 (RXRA)
Nuclear receptors [BR:rro03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   104669710 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 104669710
NCBI-ProteinID: XP_010371073
LinkDB
Position
16
AA seq 435 aa
MAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
STGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHY
GVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQE
ERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTN
ICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLA
TGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPA
EVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPI
DTFLMEMLEAPHQMT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggctgcgccctcgctgcacccgtccctggggcctggcatcggctccccagggcagttg
cactctcccatcagcaccctgagctcccccatcaatggcatgggcccgcccttctcggtc
atcagctcccccatgggcccccactccatgtcggtgcccaccacgcccaccctgggcttc
agcactggcagcccccagctcagctcacccatgaaccccgtcagcagtagcgaggacatc
aagccccccctgggcctcaatggcgtcctcaaggtccccgcccacccctcaggaaacatg
gcttccttcaccaagcacatctgcgccatctgcggggaccgctcctcaggcaagcactac
ggggtgtacagctgcgaggggtgcaagggcttcttcaagcggacggtgcgcaaggacctg
acctacacctgccgcgacaacaaggactgcctgattgacaagcggcagcggaaccggtgc
cagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaagctgtgcaggag
gagcggcagcgtggcaaggaccggaacgagaatgaggtggagtcgaccagcagcgccaac
gaggacatgccggtggagaggatcctggaggctgagctggccgtggagcccaagactgag
acctacgtggaggcgaacatggggctgaaccctagctcgccgaatgaccccgtcaccaac
atttgccaagcagccgacaagcagctcttcacgctggtggagtgggccaagcggatccca
cacttctcagagctgcccctggacgaccaggtcatcctgctgcgggcaggctggaatgaa
ctgctcatcgcctccttctcccaccgctccatcgctgtgaaggacgggatcctcctggcc
accgggctgcacgtccaccggaacagcgcccacagtgcaggggtgggcgccatctttgac
agggtgctgacggagctcgtgtccaagatgcgggacatgcagatggacaagacggagctg
ggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctctcgaacccggcc
gaggtggaggcactgagggagaaggtctacgcgtccctggaggcctactgcaagcacaag
tacccagagcagccaggaaggttcgccaagctgttgctccgcctgccggctctgcgctcc
atcgggctcaagtgcctggaacatctcttcttcttcaagctcattggggacacgcccatt
gacaccttcctcatggagatgctggaggcgccgcaccaaatgacttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670175
Entry
104670175         CDS       T03989                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03320  PPAR signaling pathway
rro04659  Th17 cell differentiation
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05216  Thyroid cancer
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104670175 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104670175 (RXRG)
   03320 PPAR signaling pathway
    104670175 (RXRG)
   04919 Thyroid hormone signaling pathway
    104670175 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    104670175 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670175 (RXRG)
   05202 Transcriptional misregulation in cancer
    104670175 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    104670175 (RXRG)
   05216 Thyroid cancer
    104670175 (RXRG)
   05222 Small cell lung cancer
    104670175 (RXRG)
   05223 Non-small cell lung cancer
    104670175 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104670175 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rro03310]
    104670175 (RXRG)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    104670175 (RXRG)
Nuclear receptors [BR:rro03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   104670175 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 104670175
NCBI-ProteinID: XP_010371665
UniProt: A0A2K6NM48
LinkDB
Position
8
AA seq 463 aa
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTVSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagctacacggacaccccagtgagtgccccacggactgtgagtgcagtgggg
acccccctcaatgccctgggctctccgtatcgagtcatcacctctgccatgggcccaccc
tcaggagcactggcagcacctccaggaatcaacctggttgccccacccagctctcagcta
aatgtggtcaacagcgtcagcagttcagaggacatcaagcccttaccagggcttcccggg
attggaaacatgaactacccatccaccagccccggatctctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactatggggtgtacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacgtgtcgggataataaagac
tgtctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgggagcgagct
gagagtgaggcagaatgtgccagtagtggtcatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaacatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ttgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccaccggagcagtgcccatagt
gctggggtcggctccatctttgacagagttctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccattgtgctctttaacccagat
gccaagggcctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgctccattggcttgaaatgtctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgttg
cagatcacctga

DBGET integrated database retrieval system