KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658073
Entry
104658073         CDS       T03989                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X2
  KO
K08528  retinoic acid receptor beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658073 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    104658073 (RARB)
   05222 Small cell lung cancer
    104658073 (RARB)
   05223 Non-small cell lung cancer
    104658073 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104658073 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rro03310]
    104658073 (RARB)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    104658073 (RARB)
Nuclear receptors [BR:rro03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   104658073 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 104658073
NCBI-ProteinID: XP_010356303
UniProt: A0A2K6QW41
LinkDB
Position
1
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcaattgaaacacagagcaccagc
tctgaggaactcgtcccaagccccccatctccacttcctccccctcgagtgtacaaaccc
tgcttcgtctgccaggacaaatcatcagggtaccactatggggtcagcgcctgtgaggga
tgtaagggctttttccgcagaagtattcagaagaatatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccaatactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagacttcgaagcaagaatgcacagagagctatgaaatgacagctgagttggacgatctc
acagagaagatccgaaaagctcaccaggaaactttcccttcgctctgccagctgggtaaa
tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa
ttcagtgaactggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcct
ggtttcactggcttgaccatcgcagaccaaatcaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttttca
gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccgacaaaa
gtagataaactacaagaaccattgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgtagcatc
agtgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaagaaatgctggagaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagtggg
gtcagtcagtcaccactcgtgcaataa

DBGET integrated database retrieval system